(data stored in ACNUC30630 zone)

EMBL: CP000113.PE99

CP000113.PE99        Location/Qualifiers
FT   CDS             117468..118238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG38"
FT                   /protein_id="ABF89119.1"
FT                   /translation="MTEQEQFEEILRELGELLLQLGDLSWNVVLIGGQVLALESLRKGG
FT                   SGVIAVTTDTGAVIERGYSHEPDLLFDMDGTEFGAERLPEVLKLRGYERTRSFRWSKTL
FT                   PGGVMHLDLFAPAGVDLEQLPTSMTPLPDARLALRGSQPVFLPMGETSLRIRLPDAVGF
FT                   LSMKVRAKLEQRPTETKDCFDIFAYVKLVGLDDVRASLKQAGEEGQALRDKLQRLFWST
FT                   DAAGVLDIIAYAEGLEEVDRALLAQAAVDLFADL"
     MTEQEQFEEI LRELGELLLQ LGDLSWNVVL IGGQVLALES LRKGGSGVIA VTTDTGAVIE        60
     RGYSHEPDLL FDMDGTEFGA ERLPEVLKLR GYERTRSFRW SKTLPGGVMH LDLFAPAGVD       120
     LEQLPTSMTP LPDARLALRG SQPVFLPMGE TSLRIRLPDA VGFLSMKVRA KLEQRPTETK       180
     DCFDIFAYVK LVGLDDVRAS LKQAGEEGQA LRDKLQRLFW STDAAGVLDI IAYAEGLEEV       240
     DRALLAQAAV DLFADL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page