(data stored in ACNUC30630 zone)

EMBL: CP000113.PILT

CP000113.PILT        Location/Qualifiers
FT   CDS             476067..477161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="MXAN_0415"
FT                   /product="twitching mobility protein"
FT                   /note="identified by similarity to SP:P24559; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90430"
FT                   /db_xref="GOA:Q1DF87"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF87"
FT                   /protein_id="ABF90430.1"
FT                   /translation="MLTRVTPLDLATLNKLLAVGVQNGASDIHFRPGDPPIYRVNGALR
FT                   PLKMEKLHADHTRQVAVHVVSDPEVKKQIDTLQECDASYSLPGVARFRVNIYRQRGSLA
FT                   CILRIIPDEIPTIDGLGLPQVLKKIAGNERGLVLVTGATGSGKSSTLAAMIDHINRTEN
FT                   LHVLTIEDPIEFIYKNIKSSISQREIGPDTQSFAIALRAALRQDPDVILVGEMRDTETI
FT                   DIALKASETGHLVLSTVHTTDASRTINRLVSVFPAEEQTMVRMRLADCLKATVSQRLLP
FT                   RASGKGRTVALEIMVQTKTVEQYIRDDRANELKDVIEKGRDMFGMQSFDQHLTQLYREG
FT                   IITLETAQSAASNPADFQRALEFE"
     MLTRVTPLDL ATLNKLLAVG VQNGASDIHF RPGDPPIYRV NGALRPLKME KLHADHTRQV        60
     AVHVVSDPEV KKQIDTLQEC DASYSLPGVA RFRVNIYRQR GSLACILRII PDEIPTIDGL       120
     GLPQVLKKIA GNERGLVLVT GATGSGKSST LAAMIDHINR TENLHVLTIE DPIEFIYKNI       180
     KSSISQREIG PDTQSFAIAL RAALRQDPDV ILVGEMRDTE TIDIALKASE TGHLVLSTVH       240
     TTDASRTINR LVSVFPAEEQ TMVRMRLADC LKATVSQRLL PRASGKGRTV ALEIMVQTKT       300
     VEQYIRDDRA NELKDVIEKG RDMFGMQSFD QHLTQLYREG IITLETAQSA ASNPADFQRA       360
     LEFE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page