(data stored in ACNUC30630 zone)

EMBL: CP000113.PPK

CP000113.PPK         Location/Qualifiers
FT   CDS             complement(62304..64466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="MXAN_0056"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by similarity to SP:Q9S646; match to
FT                   protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87163"
FT                   /db_xref="GOA:Q1DG84"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG84"
FT                   /protein_id="ABF87163.1"
FT                   /translation="MPKRGGGGRGVTQKPSNRDVLPAGAESKDTELFFNRELSWMAFND
FT                   RVLQLAESPEIPLLERLKFIAIYARNLDEFFMIRVARLHEQIRGGVARLVPDGASPSDT
FT                   LDKLHDGILKQTRRHGDAFEKVLRPALAEKGLRILSARNLDAEQRAQVDQRFKEQIFPV
FT                   LTPLAIGLGRHFPYISNLSLSLAVLLRDPDADEESVARVKVPKELLPRFLPLKGNVFVP
FT                   LEEIIAQHLGDLFPGMEVLSWGTFRVTRDADFTVSEDAEDLLKAVETELRERRFGDVIR
FT                   MEVQAGMSPKLLEPLVEAMGLEARQVYEEHGLVGLNDLQSIAFAPGFPELKDPPWVPVT
FT                   QARLRTDADAPDGGTVMSSMRRGDLLVHHPYESFATSVERFVTEAVADPDVLAIKQTVY
FT                   RTSDSSPLVPALITATERGKQAVCMVELKARFDERTNIRWANALEEAGVHVVYGIPSLK
FT                   THAKAILIVRREGDKVRHYVHIGTGNYNPKTARLYTDMGLFTTDPDIGADVADVFNYLT
FT                   GFGRPKSFRKLLVAPLTMRQGLLAEIKRTVAAHTAERPARIQMKMNALVDPGIIHALYE
FT                   ASRAGVKVELNVRGICCLRPGVPGVSENIRVVSVLGRFLEHSRIYIFERGPELRCFIGS
FT                   ADLMPRNLDHRVEILAPVEDASLAAQVKDSLERCMADTTSAWELTADGGWRRRLPRAGD
FT                   EKRWAQGEMMERAQRMAQFQGGRPLP"
     MPKRGGGGRG VTQKPSNRDV LPAGAESKDT ELFFNRELSW MAFNDRVLQL AESPEIPLLE        60
     RLKFIAIYAR NLDEFFMIRV ARLHEQIRGG VARLVPDGAS PSDTLDKLHD GILKQTRRHG       120
     DAFEKVLRPA LAEKGLRILS ARNLDAEQRA QVDQRFKEQI FPVLTPLAIG LGRHFPYISN       180
     LSLSLAVLLR DPDADEESVA RVKVPKELLP RFLPLKGNVF VPLEEIIAQH LGDLFPGMEV       240
     LSWGTFRVTR DADFTVSEDA EDLLKAVETE LRERRFGDVI RMEVQAGMSP KLLEPLVEAM       300
     GLEARQVYEE HGLVGLNDLQ SIAFAPGFPE LKDPPWVPVT QARLRTDADA PDGGTVMSSM       360
     RRGDLLVHHP YESFATSVER FVTEAVADPD VLAIKQTVYR TSDSSPLVPA LITATERGKQ       420
     AVCMVELKAR FDERTNIRWA NALEEAGVHV VYGIPSLKTH AKAILIVRRE GDKVRHYVHI       480
     GTGNYNPKTA RLYTDMGLFT TDPDIGADVA DVFNYLTGFG RPKSFRKLLV APLTMRQGLL       540
     AEIKRTVAAH TAERPARIQM KMNALVDPGI IHALYEASRA GVKVELNVRG ICCLRPGVPG       600
     VSENIRVVSV LGRFLEHSRI YIFERGPELR CFIGSADLMP RNLDHRVEIL APVEDASLAA       660
     QVKDSLERCM ADTTSAWELT ADGGWRRRLP RAGDEKRWAQ GEMMERAQRM AQFQGGRPLP       720
//

If you have problems or comments...

PBIL Back to PBIL home page