(data stored in ACNUC30630 zone)

EMBL: CP000113.SUGE

CP000113.SUGE        Location/Qualifiers
FT   CDS             446752..447081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="MXAN_0384"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   SugE"
FT                   /note="identified by similarity to SP:P30743; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91561"
FT                   /db_xref="GOA:Q1DFB7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB7"
FT                   /protein_id="ABF91561.1"
FT                   /translation="MSWLLVLVAGLLETCWAVGLKYTQGFTRPWPSLFVAVTLISSLAL
FT                   LSIAMRTLPAGTAYAVWVGIGALGAALVGIVLFREPATLGRFFFLGLMVVSVIGLKFTS
FT                   GGDAH"
     MSWLLVLVAG LLETCWAVGL KYTQGFTRPW PSLFVAVTLI SSLALLSIAM RTLPAGTAYA        60
     VWVGIGALGA ALVGIVLFRE PATLGRFFFL GLMVVSVIGL KFTSGGDAH                   109
//

If you have problems or comments...

PBIL Back to PBIL home page