(data stored in ACNUC30630 zone)

EMBL: CP000113.TONB

CP000113.TONB        Location/Qualifiers
FT   CDS             complement(329523..330332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="MXAN_0276"
FT                   /product="ferric siderophore transporter, periplasmic
FT                   energy transduction protein TonB"
FT                   /note="identified by similarity to GB:AAF04082.1; match to
FT                   protein family HMM PF03544; match to protein family HMM
FT                   TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91400"
FT                   /db_xref="GOA:Q1DFL6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL6"
FT                   /protein_id="ABF91400.1"
FT                   /translation="MASLYARPVMFETFDSGPDVQSARRFALSTTASVAVFALMGIAAV
FT                   TAAGKVTEVIKEKKGTDVVFRPPPPPPPPPVVEAKPPPPPPPPPKPKLAPKPAPPAAAK
FT                   APPPAAPTVAPAPIVVPKEVPLEKPPEAATETVAAAPIAVGGTGALVPGGVVGGVPGGD
FT                   TLAGGGGRVAPINLPESGTPPEPLSSNLTPEYPSEARSKGLEGMVILKGVVGVDGRVSQ
FT                   LKVMRGDEPFASAAMAAAKTWRFKPAVVGGQPTAVFRIFKVPFRLKS"
     MASLYARPVM FETFDSGPDV QSARRFALST TASVAVFALM GIAAVTAAGK VTEVIKEKKG        60
     TDVVFRPPPP PPPPPVVEAK PPPPPPPPPK PKLAPKPAPP AAAKAPPPAA PTVAPAPIVV       120
     PKEVPLEKPP EAATETVAAA PIAVGGTGAL VPGGVVGGVP GGDTLAGGGG RVAPINLPES       180
     GTPPEPLSSN LTPEYPSEAR SKGLEGMVIL KGVVGVDGRV SQLKVMRGDE PFASAAMAAA       240
     KTWRFKPAVV GGQPTAVFRI FKVPFRLKS                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page