(data stored in ACNUC30630 zone)

EMBL: CP000113.TREZ

CP000113.TREZ        Location/Qualifiers
FT   CDS             621391..623256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ"
FT                   /locus_tag="MXAN_0541"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02402"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90802"
FT                   /db_xref="GOA:Q1DEW3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW3"
FT                   /protein_id="ABF90802.1"
FT                   /translation="MPMGPADESRAARSKAPLLGAWVEAGERVRWRVWAPGHQRVEVVL
FT                   HDAQGNPGRVLPMTPEPGDCFGAVLEGQGAGLRYKLRVDGEGPFPDPWSRSQPQGVHGP
FT                   SEVVVPDFAWTDAGWKGVAPQALVIYEVHVGTATPEGTFESLIPRLAGLKELGITALEL
FT                   MPVASFPGRRNWGYDGVSLFAPQQAYGGPEGLRRLVDAAHAHGLAVLMDAVYNHFGPDG
FT                   NYLRVYSPHYFTGRHHTPWGDAVNYDGEGSAHARTQVLANVEMWIADYHLDGLRLDAAH
FT                   AIIDDGTPHLLTEVAERARACAPGRKVHVIAEDERNERRLMRPASEGGLGLDGVWADDF
FT                   HHQLRRAFAGDSDGYYQDYTGNTEDLARTLNQGWFYEGQVSKNLGHARGTKADGLEPWR
FT                   FVHCIQNHDQVGNRAFGERLGHDVSPAAFRAMSGLLLLSPYTPMLFMGQEWNASTPFLY
FT                   FTEHHAELGKLVTEGRRKEFAGFARFAGAEVPDPQADDTFTRSQLDWAEAEQPGHAGVR
FT                   ALYRELLRLRASEPALRETGRGSYAARALGPDALVLERRGGGQRLQVLLSLRGALDYPV
FT                   PAGSALVLWTEDACFGGSEKLQPLKQDTVRLKGSALAVIRLPAKD"
     MPMGPADESR AARSKAPLLG AWVEAGERVR WRVWAPGHQR VEVVLHDAQG NPGRVLPMTP        60
     EPGDCFGAVL EGQGAGLRYK LRVDGEGPFP DPWSRSQPQG VHGPSEVVVP DFAWTDAGWK       120
     GVAPQALVIY EVHVGTATPE GTFESLIPRL AGLKELGITA LELMPVASFP GRRNWGYDGV       180
     SLFAPQQAYG GPEGLRRLVD AAHAHGLAVL MDAVYNHFGP DGNYLRVYSP HYFTGRHHTP       240
     WGDAVNYDGE GSAHARTQVL ANVEMWIADY HLDGLRLDAA HAIIDDGTPH LLTEVAERAR       300
     ACAPGRKVHV IAEDERNERR LMRPASEGGL GLDGVWADDF HHQLRRAFAG DSDGYYQDYT       360
     GNTEDLARTL NQGWFYEGQV SKNLGHARGT KADGLEPWRF VHCIQNHDQV GNRAFGERLG       420
     HDVSPAAFRA MSGLLLLSPY TPMLFMGQEW NASTPFLYFT EHHAELGKLV TEGRRKEFAG       480
     FARFAGAEVP DPQADDTFTR SQLDWAEAEQ PGHAGVRALY RELLRLRASE PALRETGRGS       540
     YAARALGPDA LVLERRGGGQ RLQVLLSLRG ALDYPVPAGS ALVLWTEDAC FGGSEKLQPL       600
     KQDTVRLKGS ALAVIRLPAK D                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page