(data stored in ACNUC30630 zone)

EMBL: CP000113.YCHF

CP000113.YCHF        Location/Qualifiers
FT   CDS             465949..467058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="MXAN_0405"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88488"
FT                   /db_xref="GOA:Q1DF97"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF97"
FT                   /protein_id="ABF88488.1"
FT                   /translation="MGLSIGIVGLPNVGKSTLFNALSAAGAQAANYPFCTIEPNVGVVP
FT                   VPDDRLDKLSALIKPLKKVPTSLEFVDIAGLVRGASKGEGLGNQFLGNIRQVNAVLHVL
FT                   RCFEDDNVTHVEGGVNPVRDRDVVDTELCLKDLETVEKRRERSLKNTKVGGKAGEEAKA
FT                   EVALLDRIKASLDNGITVRAQKLTEEESAVIHDLFLLTDKPVLYVANIGESELGKEDAN
FT                   PHVKAVREMAAKEGFEVVVLAAALESEIQQLPESERPGFLESAGLSEPGLHKVVRAGYK
FT                   LLGLWTYFTVGEQECRAWTIHQGYKAPQAAGVIHSDFERGFIKAEVMRWEDLVKLGSES
FT                   AVKEKGMLRVEGKEYVVQDGDCMHFRFNV"
     MGLSIGIVGL PNVGKSTLFN ALSAAGAQAA NYPFCTIEPN VGVVPVPDDR LDKLSALIKP        60
     LKKVPTSLEF VDIAGLVRGA SKGEGLGNQF LGNIRQVNAV LHVLRCFEDD NVTHVEGGVN       120
     PVRDRDVVDT ELCLKDLETV EKRRERSLKN TKVGGKAGEE AKAEVALLDR IKASLDNGIT       180
     VRAQKLTEEE SAVIHDLFLL TDKPVLYVAN IGESELGKED ANPHVKAVRE MAAKEGFEVV       240
     VLAAALESEI QQLPESERPG FLESAGLSEP GLHKVVRAGY KLLGLWTYFT VGEQECRAWT       300
     IHQGYKAPQA AGVIHSDFER GFIKAEVMRW EDLVKLGSES AVKEKGMLRV EGKEYVVQDG       360
     DCMHFRFNV                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page