(data stored in SCRATCH9089 zone)

EMBL: CP000124.ACEK

CP000124.ACEK        Location/Qualifiers
FT   CDS             complement(593701..595512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="BURPS1710b_0581"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="2.7.11.5"
FT                   /note="identified by match to protein family HMM PF06315"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49915"
FT                   /db_xref="GOA:Q3JWQ8"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWQ8"
FT                   /protein_id="ABA49915.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTILENFDRHYRIFREAAVEAKDLFERA
FT                   DWHGLQRLARERITSYDDRVRECVELLEDEYDAENIDNEVWPQIKLHYIGLLTSHRQPE
FT                   CAETFFNSVCCKILHRAYFNNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGSEGLAAT
FT                   LERIVTNFQLNPPFEDLERDIACIMQAIHDEFGAFDEAVNFQIHVLSSLFYRNKTAYVV
FT                   GRIINGDRVLPFAVPIRHARAGILALDTVLLRRDQLKIIFSFSHSYFLVDMNVPSAYVQ
FT                   FLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDRFIVAPGIKGLVMLVFTL
FT                   PSFPYVFKMIKDHFPPPKDTTREQIMAKYLLVKRHDRLGRMADTLEYSSVALPLARLDD
FT                   ALVRELEKEVPSLIEYEGENLVIKHLYIERRMVPLNLYLQNGSDAEIEHGVREYGNAVK
FT                   ELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRVPPPRNDEDEMSGEPW
FT                   YTVGPHDIFPETYAPFLLGDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYE
FT                   PALRFCIRYPERFAPGDAADGGKLAAA"
     MNHFPKLLSS QIGFDVAQTI LENFDRHYRI FREAAVEAKD LFERADWHGL QRLARERITS        60
     YDDRVRECVE LLEDEYDAEN IDNEVWPQIK LHYIGLLTSH RQPECAETFF NSVCCKILHR       120
     AYFNNDFIFV RPAISTEYIE NDEPAAKPTY RAYYPGSEGL AATLERIVTN FQLNPPFEDL       180
     ERDIACIMQA IHDEFGAFDE AVNFQIHVLS SLFYRNKTAY VVGRIINGDR VLPFAVPIRH       240
     ARAGILALDT VLLRRDQLKI IFSFSHSYFL VDMNVPSAYV QFLRSIMPGK PKAEIYTSVG       300
     LQKQGKNLFY RDLLHHLSHS SDRFIVAPGI KGLVMLVFTL PSFPYVFKMI KDHFPPPKDT       360
     TREQIMAKYL LVKRHDRLGR MADTLEYSSV ALPLARLDDA LVRELEKEVP SLIEYEGENL       420
     VIKHLYIERR MVPLNLYLQN GSDAEIEHGV REYGNAVKEL MQANIFPGDM LYKNFGVTRH       480
     GRVVFYDYDE IEYLTDCNVR RVPPPRNDED EMSGEPWYTV GPHDIFPETY APFLLGDPRV       540
     REHFLAHHAD FFDPQLWQDS KDRLLRGELP DFFAYEPALR FCIRYPERFA PGDAADGGKL       600
     AAA                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page