(data stored in SCRATCH9089 zone)

EMBL: CP000124.ACOD

CP000124.ACOD        Location/Qualifiers
FT   CDS             146253..147773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoD"
FT                   /locus_tag="BURPS1710b_0138"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47698"
FT                   /db_xref="GOA:Q3JXZ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ9"
FT                   /protein_id="ABA47698.1"
FT                   /translation="MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGR
FT                   PFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRIADRMEANLTRLAVAETI
FT                   DNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIP
FT                   WNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLE
FT                   AGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDS
FT                   YFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDSQTMI
FT                   GAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIF
FT                   QEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF"
     MNHADMQHLN IEFPYRKQYG NFIGGEWVAP VGGEYFDNVS PVTGRPFTAI PRSREADIEL        60
     ALDAAHAAKA GWAAKGAAER ANVLLRIADR MEANLTRLAV AETIDNGKPL RETTAADVPL       120
     AIDHFRYFAG CIRAQEGSIA DIGGDMVAYH FHEPLGVVGQ IIPWNFPLLM AAWKLAPALA       180
     AGNCVVLKPA EQTPASILVF AELIQDLLPP GVLNIVNGFG LEAGKPLASS KRIAKIAFTG       240
     ETSTGRLIMQ YASENLIPVT LELGGKSPNI FFADVMDRDD SYFDKALEGF AMFALNQGEV       300
     CTCPSRALVE ESIYDRFIER ALKRVEAIKQ GHPLDSQTMI GAQASAEQLE KILSYIDIGR       360
     GEGAQCLTGG ERNVLGGELA EGYYVKPTVF RGHNKMRIFQ EEIFGPVLAV TTFKTEEEAL       420
     EIANDTLYGL GAGVWTRDGN RAYRFGRGIQ AGRVWTNCYH AYPAHAAFGG YKQSGIGRET       480
     HKMMLDHYQQ TKNLLVSYSE KPLGFF                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page