(data stored in SCRATCH9089 zone)

EMBL: CP000124.ADHC

CP000124.ADHC        Location/Qualifiers
FT   CDS             complement(388933..389997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="BURPS1710b_0372"
FT                   /product="NADP-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.2"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49011"
FT                   /db_xref="GOA:Q3JXB7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB7"
FT                   /protein_id="ABA49011.1"
FT                   /translation="MSTTYAYAATSATTPLAPFEFARRALRDLDVQIEILYCGVCHSDL
FT                   HQARNEWKNTTYPVVPGHEIVGRVTAVGAQVTRFEAGELVGVGCLVDSCRTCPNCAQGL
FT                   EQYCENGFVGTYNGRDRATGDITYGGYSTQIVVDEAFVLRVPDTLDPAGAAPLLCAGIT
FT                   TYSPLRQWGAGPGKKIGIVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHE
FT                   VVISKDDAQMNAHLNSFDFILNTVAAQHDLNPFIGLLKLDGTMTLVGAPEHDHPSPRVF
FT                   NLIYKRRRLAGSLIGGIAETQEMLDFCAQHGITSDIEVIPMSQINAAYERMLTSDVKYR
FT                   FVIDIGSIRPQRAA"
     MSTTYAYAAT SATTPLAPFE FARRALRDLD VQIEILYCGV CHSDLHQARN EWKNTTYPVV        60
     PGHEIVGRVT AVGAQVTRFE AGELVGVGCL VDSCRTCPNC AQGLEQYCEN GFVGTYNGRD       120
     RATGDITYGG YSTQIVVDEA FVLRVPDTLD PAGAAPLLCA GITTYSPLRQ WGAGPGKKIG       180
     IVGLGGLGHM GVKLARAMGA HVVLFTTSPS KIEDGKRLGA HEVVISKDDA QMNAHLNSFD       240
     FILNTVAAQH DLNPFIGLLK LDGTMTLVGA PEHDHPSPRV FNLIYKRRRL AGSLIGGIAE       300
     TQEMLDFCAQ HGITSDIEVI PMSQINAAYE RMLTSDVKYR FVIDIGSIRP QRAA             354
//

If you have problems or comments...

PBIL Back to PBIL home page