(data stored in SCRATCH9089 zone)

EMBL: CP000124.AHCY

CP000124.AHCY        Location/Qualifiers
FT   CDS             complement(60670..62091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="BURPS1710b_0057"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF02826; match to protein
FT                   family HMM PF05221; match to protein family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47924"
FT                   /db_xref="GOA:Q3JY79"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="PDB:3D64"
FT                   /db_xref="PDB:3GLQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY79"
FT                   /protein_id="ABA47924.1"
FT                   /translation="MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDE
FT                   YKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGT
FT                   PVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIARP
FT                   TNEEEVALFKSIERHLEIDGSWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFN
FT                   VNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGAT
FT                   VWVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNYHVINHDHMKAMRHNAIVC
FT                   NIGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVM
FT                   SNSFTNQTLAQIELFTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQAAYI
FT                   GVSKAGPFKPDHYRY"
     MNAAVIDSHS AQDYVVADIA LAGWGRKELN IAETEMPGLV QIRDEYKAQQ PLKGARIAGS        60
     LHMTIQTGVL IETLKALGAD VRWASCNIFS TQDHAAAAIV EAGTPVFAFK GESLDEYWEF       120
     SHRIFEWPNG EFANMILDDG GDATLLLILG SKAEKDRSVI ARPTNEEEVA LFKSIERHLE       180
     IDGSWYSKRL AHIKGVTEET TTGVHRLYQM EKDGRLPFPA FNVNDSVTKS KFDNLYGCRE       240
     SLVDGIKRAT DVMIAGKIAV VAGYGDVGKG CAQSLRGLGA TVWVTEIDPI CALQAAMEGY       300
     RVVTMEYAAD KADIFVTATG NYHVINHDHM KAMRHNAIVC NIGHFDSEID VASTRQYQWE       360
     NIKPQVDHII FPDGKRVILL AEGRLVNLGC ATGHPSFVMS NSFTNQTLAQ IELFTRGGEY       420
     ANKVYVLPKH LDEKVARLHL ARIGAQLSEL SDDQAAYIGV SKAGPFKPDH YRY              473
//

If you have problems or comments...

PBIL Back to PBIL home page