(data stored in SCRATCH9089 zone)

EMBL: CP000124.ALKA

CP000124.ALKA        Location/Qualifiers
FT   CDS             336808..337839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BURPS1710b_0323"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="identified by match to protein family HMM PF00730;
FT                   match to protein family HMM PF06029"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49044"
FT                   /db_xref="GOA:Q3JXG4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG4"
FT                   /protein_id="ABA49044.1"
FT                   /translation="MGLAAQGGAPRCRGAPRGGRIRRIRRGPRSLSAAVEPAAVRPDSV
FT                   VLELPFKSPYDWPRVLRFFAGRAIPGVEAVGDGAYRRTVDHHGAIGTLTVRKHPRKRCL
FT                   VALVEGDAARHADAAFAARLSTMFDLQADPAAIGAHLARDAWFAPLVGAAPGLRVPGAW
FT                   SGFELIVRAIVGQQVSVKAATTIVGRLVERAGERLAPHAPGAIGWRFPEPAALAACDVS
FT                   RIGMPGKRAAALQGVARAVASGDVPLEAYASDPAGVRAALLALPGIGPWTVEYVAMRAW
FT                   RDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSA
FT                   RGG"
     MGLAAQGGAP RCRGAPRGGR IRRIRRGPRS LSAAVEPAAV RPDSVVLELP FKSPYDWPRV        60
     LRFFAGRAIP GVEAVGDGAY RRTVDHHGAI GTLTVRKHPR KRCLVALVEG DAARHADAAF       120
     AARLSTMFDL QADPAAIGAH LARDAWFAPL VGAAPGLRVP GAWSGFELIV RAIVGQQVSV       180
     KAATTIVGRL VERAGERLAP HAPGAIGWRF PEPAALAACD VSRIGMPGKR AAALQGVARA       240
     VASGDVPLEA YASDPAGVRA ALLALPGIGP WTVEYVAMRA WRDADAWPAT DLVLMQAIVA       300
     RDPALDRPAS QRLRADAWRP WRAYAAMHLW NEIADRAGSA RGG                         343
//

If you have problems or comments...

PBIL Back to PBIL home page