(data stored in SCRATCH9089 zone)

EMBL: CP000124.AQPZ

CP000124.AQPZ        Location/Qualifiers
FT   CDS             87489..88193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="BURPS1710b_0085"
FT                   /product="aquaporin Z"
FT                   /note="identified by match to protein family HMM PF00230;
FT                   match to protein family HMM TIGR00861"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49443"
FT                   /db_xref="GOA:Q3JY51"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY51"
FT                   /protein_id="ABA49443.1"
FT                   /translation="MKLPQRLAAEVFGTFWLVLGGCGSAVLAAAFPGLGIGFAGVALAF
FT                   GLTVLTMAFAIGHVSGCHLNPAVSVGLTVAGRFPARDLVPYVIAQVIGATLGAFVLYLI
FT                   ATGKPGFDVAGSGFATNGYDARSPGHYSLAAAFICEVVLTGFFLFVILGSTDKRAPAGF
FT                   APIAIGLCLTLIHLISIPVTNTSVNPARSTGPALFVGGEAIGQLWLFWVAPIIGAAIAG
FT                   VVYPLVAGRDES"
     MKLPQRLAAE VFGTFWLVLG GCGSAVLAAA FPGLGIGFAG VALAFGLTVL TMAFAIGHVS        60
     GCHLNPAVSV GLTVAGRFPA RDLVPYVIAQ VIGATLGAFV LYLIATGKPG FDVAGSGFAT       120
     NGYDARSPGH YSLAAAFICE VVLTGFFLFV ILGSTDKRAP AGFAPIAIGL CLTLIHLISI       180
     PVTNTSVNPA RSTGPALFVG GEAIGQLWLF WVAPIIGAAI AGVVYPLVAG RDES             234
//

If you have problems or comments...

PBIL Back to PBIL home page