(data stored in SCRATCH9089 zone)

EMBL: CP000124.ARGB

CP000124.ARGB        Location/Qualifiers
FT   CDS             complement(397456..398511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="BURPS1710b_0380"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48851"
FT                   /db_xref="GOA:Q3JXA9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXA9"
FT                   /protein_id="ABA48851.1"
FT                   /translation="MRIAQENLTFPAAAPDFDTPAAHRPNGQKPHAALRHSCTIPPVST
FT                   FRTRAAAMSEPIDLSQISPALKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGF
FT                   ARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGE
FT                   VQQDIVTLINHFGGHAVGLTGKDGGLIHARKLMMPDRDNPGEYVDIGQVGEVEAINPAV
FT                   VKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLVMMTNIPGVMDKEG
FT                   NLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHSVLLEILT
FT                   EQPFGTMIRSH"
     MRIAQENLTF PAAAPDFDTP AAHRPNGQKP HAALRHSCTI PPVSTFRTRA AAMSEPIDLS        60
     QISPALKAEI LAEALPYIRR YHGKTVVIKY GGNAMTEERL KQGFARDVIL LKLVGINPVI       120
     VHGGGPQIDQ ALKKIGKQGT FIQGMRVTDE ETMEVVEWVL GGEVQQDIVT LINHFGGHAV       180
     GLTGKDGGLI HARKLMMPDR DNPGEYVDIG QVGEVEAINP AVVKALQDDA FIPVISPIGF       240
     GEDGLSYNIN ADLVAGKLAT VLNAEKLVMM TNIPGVMDKE GNLLTDLSAR EIDALFEDGT       300
     ISGGMLPKIS SALDAAKSGV KSVHIVDGRI EHSVLLEILT EQPFGTMIRS H                351
//

If you have problems or comments...

PBIL Back to PBIL home page