(data stored in SCRATCH9089 zone)

EMBL: CP000124.ARGC

CP000124.ARGC        Location/Qualifiers
FT   CDS             27002..27946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BURPS1710b_0023"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM TIGR01851"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48897"
FT                   /db_xref="GOA:Q3JYB2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB2"
FT                   /protein_id="ABA48897.1"
FT                   /translation="MSTRVFVDGQEGTTGLKIFEYLLARSDIDILRIDEAKRKDVDERR
FT                   RLINASDVTFLCLPDVASRESATLVENPNTTLIDASTAFRTSADWAYGLPELNRAQRER
FT                   IRGAKRIAVPGCHASAFVLAMRPLVDAGVVAPGFAAHSYSITGYSGGGKKMIADYEAGG
FT                   AKLASPRPYALGLAHKHLPEMAAHTGLTSAPIFTPIVGPFYKGLAVTTYFTPGQLAKRV
FT                   TPQDVQRVLAEHYAGEAFVRVAPYDAAENLDDGFFDVQANNDTNRVDLFVFGTAERFVT
FT                   VARLDNLGKGASGAAIQCMNLNVGAAEGTGLAR"
     MSTRVFVDGQ EGTTGLKIFE YLLARSDIDI LRIDEAKRKD VDERRRLINA SDVTFLCLPD        60
     VASRESATLV ENPNTTLIDA STAFRTSADW AYGLPELNRA QRERIRGAKR IAVPGCHASA       120
     FVLAMRPLVD AGVVAPGFAA HSYSITGYSG GGKKMIADYE AGGAKLASPR PYALGLAHKH       180
     LPEMAAHTGL TSAPIFTPIV GPFYKGLAVT TYFTPGQLAK RVTPQDVQRV LAEHYAGEAF       240
     VRVAPYDAAE NLDDGFFDVQ ANNDTNRVDL FVFGTAERFV TVARLDNLGK GASGAAIQCM       300
     NLNVGAAEGT GLAR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page