(data stored in SCRATCH9089 zone)

EMBL: CP000124.ARGG

CP000124.ARGG        Location/Qualifiers
FT   CDS             506054..507394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="BURPS1710b_0501"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50402"
FT                   /db_xref="GOA:Q3JWY8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWY8"
FT                   /protein_id="ABA50402.1"
FT                   /translation="MTTILENLPAGQKVGIAFSGGLDTSAALHWMRIKGAVPYAYTANL
FT                   GQPDEDDYDAIPKRAIQYGAEGARLIDCRAQLVAEGIAALQCGAFHISTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQQFI
FT                   DELGGRAEMSEFMRQAGFEYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMG
FT                   VAFWRDDVKIDKEEVTIRFEEGRPVALNGVEYKDAVALLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVARAVTGEVTVELRRGNDYSIIGTRSPNLTYQPERLSMEKVQSMFSPR
FT                   DRIGQLTMRNLDITDTRDKLRIYSQVGLLAAGESSALPKLKEDESGN"
     MTTILENLPA GQKVGIAFSG GLDTSAALHW MRIKGAVPYA YTANLGQPDE DDYDAIPKRA        60
     IQYGAEGARL IDCRAQLVAE GIAALQCGAF HISTAGVTYF NTTPIGRAVT GTMLVAAMKE       120
     DGVNIWGDGS TYKGNDIERF YRYGLLVNPD LKIYKPWLDQ QFIDELGGRA EMSEFMRQAG       180
     FEYKMSAEKA YSTDSNLLGA THEAKDLESL ESGIKIVNPI MGVAFWRDDV KIDKEEVTIR       240
     FEEGRPVALN GVEYKDAVAL LLEANRIGGR HGLGMSDQIE NRIIEAKSRG IYEAPGLALL       300
     YIAYERLVTG IHNEDTIEQY RENGRRLGRL LYQGRWFDPQ AIMLRETAQR WVARAVTGEV       360
     TVELRRGNDY SIIGTRSPNL TYQPERLSME KVQSMFSPRD RIGQLTMRNL DITDTRDKLR       420
     IYSQVGLLAA GESSALPKLK EDESGN                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page