(data stored in SCRATCH9089 zone)

EMBL: CP000124.ARGS

CP000124.ARGS        Location/Qualifiers
FT   CDS             complement(605616..607400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BURPS1710b_0592"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51032"
FT                   /db_xref="GOA:Q3JWP7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWP7"
FT                   /protein_id="ABA51032.1"
FT                   /translation="MLPAQKHTLETLLENSVKQVVQASKGDADAAFVLPAIALERPKVA
FT                   AHGDVACNVALQLAKPLGANPRQLAEQIVAALTAQPEAAGLVDAAEIAGPGFINLRLTP
FT                   ASKQAVIGAVLAQGRAFGASERDHDKRVLLEFVSANPTGPLHVGHGRQAALGDALANVL
FT                   ASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIARDYL
FT                   NGETVAASDGEPVTGKRDVEDLEAIRKFAVTYLRREQDMDLKAFGVKFDQYYLESSLYT
FT                   EGRVEKTVDALIAAGMTYEQEGALWLRTTDEGDDKDRVMRKTDGTYTYFVPDVAYHVTK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEGSPELLDEATITRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVYYVQYAHARICSVINEWKSRYGATDALLPGADLSPLDSKQAMALMQK
FT                   LAEYPDVLAHAAGELAPHAVAFYLRELASEFHSFYNAERVLVDEQAPRTARVALLAATR
FT                   QVLENGLAMLGVSAPSKM"
     MLPAQKHTLE TLLENSVKQV VQASKGDADA AFVLPAIALE RPKVAAHGDV ACNVALQLAK        60
     PLGANPRQLA EQIVAALTAQ PEAAGLVDAA EIAGPGFINL RLTPASKQAV IGAVLAQGRA       120
     FGASERDHDK RVLLEFVSAN PTGPLHVGHG RQAALGDALA NVLASQGYAV HREFYYNDAG       180
     VQIGNLAIST QARARGLKPG DAGWPEAAYN GEYIADIARD YLNGETVAAS DGEPVTGKRD       240
     VEDLEAIRKF AVTYLRREQD MDLKAFGVKF DQYYLESSLY TEGRVEKTVD ALIAAGMTYE       300
     QEGALWLRTT DEGDDKDRVM RKTDGTYTYF VPDVAYHVTK WERGFTKVIN IQGSDHHGTI       360
     ARVRAGLQGL HIGIPKGYPD YVLHKMVTVM RDGQEVKISK RAGSYVTVRD LIEWSGGATP       420
     GSEGSPELLD EATITRGRDA VRFFLISRKA DTEFVFDIDL ALKQNDENPV YYVQYAHARI       480
     CSVINEWKSR YGATDALLPG ADLSPLDSKQ AMALMQKLAE YPDVLAHAAG ELAPHAVAFY       540
     LRELASEFHS FYNAERVLVD EQAPRTARVA LLAATRQVLE NGLAMLGVSA PSKM             594
//

If you have problems or comments...

PBIL Back to PBIL home page