(data stored in SCRATCH9089 zone)

EMBL: CP000124.ATPA

CP000124.ATPA        Location/Qualifiers
FT   CDS             complement(185292..186833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BURPS1710b_0181"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50909"
FT                   /db_xref="GOA:Q3JXV6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV6"
FT                   /protein_id="ABA50909.1"
FT                   /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELV
FT                   GRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQ
FT                   RELIIGDRQCGKTAVAIDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTI
FT                   VVAASASESAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDD
FT                   LDVKDVLPFEKGLREYLKTSHADLIKRIEDTKDLSKDDESALHAALKDFKKSGAY"
     MQLNPSEISE LIKSRIQGLE ASADVRNQGT VISVTDGIVR IHGLSDVMQG EMLEFPGNTF        60
     GLALNLERDS VGAVILGEYE HISEGDIVKT TGRILEVPVG PELVGRVVDA LGNPIDGKGP       120
     VNAKLTDAIE KIAPGVIWRK SVSQPVQTGL KSIDSMVPIG RGQRELIIGD RQCGKTAVAI       180
     DTIINQKGKD LICIYVAIGQ KASSIMNVVR KLEETGALEY TIVVAASASE SAAMQYLAPY       240
     AGCTMGEYFR DRGQDALIIY DDLTKQAWAY RQISLLLRRP PGREAYPGDV FYLHSRLLER       300
     AARVSEEYVE KFTNGEVKGK SGSLTALPVI ETQAGDVTAF VPTNVISITD GQIFLETDLF       360
     NAGIRPAINA GVSVSRVGGA AQTKVVKKLS GGIRTDLAQY RELAAFAQFA SDLDEATRKQ       420
     LERGRRVTEL LKQPQYQPLQ VWELAVSLFS ANNGYLDDLD VKDVLPFEKG LREYLKTSHA       480
     DLIKRIEDTK DLSKDDESAL HAALKDFKKS GAY                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page