(data stored in SCRATCH9089 zone)

EMBL: CP000124.ATPC

CP000124.ATPC        Location/Qualifiers
FT   CDS             complement(182110..182535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BURPS1710b_0177"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00401;
FT                   match to protein family HMM PF02823; match to protein
FT                   family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49500"
FT                   /db_xref="GOA:Q3JXW0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXW0"
FT                   /protein_id="ABA49500.1"
FT                   /translation="MATIKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRI
FT                   RPGAVRIESESGDEEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEET
FT                   LQNAKSDIDLAKAQSELATAMAQLEAIQRLAKIRGKH"
     MATIKVDVVS AEEQIFSGQA KFVALPGEAG ELGILPGHTP LITRIRPGAV RIESESGDEE        60
     FVFVAGGILE VQPGAVTVLA DTAIRGKDLD AAKAEEARKR AEETLQNAKS DIDLAKAQSE       120
     LATAMAQLEA IQRLAKIRGK H                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page