(data stored in SCRATCH9089 zone)

EMBL: CP000124.ATPG

CP000124.ATPG        Location/Qualifiers
FT   CDS             complement(184345..185220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="BURPS1710b_0180"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47826"
FT                   /db_xref="GOA:Q3JXV7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV7"
FT                   /protein_id="ABA47826.1"
FT                   /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPY
FT                   AEKVRAIAAHMSRANPEYRHPFMVANDGVKTAGMILVTTDKGLCGGLNTNVLRASLQKF
FT                   KELEEQGQKVEATAIGGKGLGFLNRFGAKVISQVVHLGDTPHLDKLIGAVKTQLDLYSE
FT                   GKLSAVYLAYTRFVNTMKQETVIEQLLPLSSEHFDANDGTPATSWDYIYEPDAQAVVDE
FT                   LLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKEL
FT                   SEIVGGAAAV"
     MAGMKEIRGK IKSVQNTRKI TKAMEMVAAS KMRRAQERMR AARPYAEKVR AIAAHMSRAN        60
     PEYRHPFMVA NDGVKTAGMI LVTTDKGLCG GLNTNVLRAS LQKFKELEEQ GQKVEATAIG       120
     GKGLGFLNRF GAKVISQVVH LGDTPHLDKL IGAVKTQLDL YSEGKLSAVY LAYTRFVNTM       180
     KQETVIEQLL PLSSEHFDAN DGTPATSWDY IYEPDAQAVV DELLVRYVEA LVYQAVAENM       240
     ASEQSARMVA MKAASDNAKT VISELQLSYN KSRQAAITKE LSEIVGGAAA V                291
//

If you have problems or comments...

PBIL Back to PBIL home page