(data stored in SCRATCH9089 zone)

EMBL: CP000124.BETA

CP000124.BETA        Location/Qualifiers
FT   CDS             complement(208179..209864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="BURPS1710b_0201"
FT                   /product="oxidoreductase, GMC family protein"
FT                   /EC_number="1.1.99.-"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49390"
FT                   /db_xref="GOA:Q3JXT6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT6"
FT                   /protein_id="ABA49390.1"
FT                   /translation="MTTERTLEGEFDYVIVGAGTAGCVLANRLTEDPDVTVLLLEAGGR
FT                   DDYHWIHIPVGYLYCIGNPRTDWLYKTEPEAGLNGRALSYPRGRVLGGSSSINGMIYMR
FT                   GQRGDYDDWARATGDAGWSWDSVLPVFRRSEDHHAGATDMHGAGGMWRVEKQRLRWEIL
FT                   EAFSQAAQQTGIPATDDFNRGDNTGVGYFEVNQKRGIRWNASKAFLRPALARPNLTVIT
FT                   GAQAERLVFDGKRCAGVEYRGGGAPFVARARVEVLVASGAVNSPQLLELSGIGDGSRLQ
FT                   ALGIGVVADLRGVGENLQDHLQLRMAFRVRGVRTLNTLSAHWWGKLWIGAQYALMQRGP
FT                   MSMAPSQLGAFAKSDPNDPALAQPDLEYHVQPLSLERFGEPLHRFNAFTASVCHLRPTS
FT                   RGSVHAASPDPARAPSIAPNYLSTDYDRHVAANALRLTRRIASAPALARYAPEEILPGA
FT                   RYVSEAELIAAAGAVGTTIFHPVGTCRMGRADDPDAVVDSRLRVRGVTGLRIVDASVMP
FT                   TITSGNTNSPTLMIAERASDMIRADRRGASERGASARAEAVLPT"
     MTTERTLEGE FDYVIVGAGT AGCVLANRLT EDPDVTVLLL EAGGRDDYHW IHIPVGYLYC        60
     IGNPRTDWLY KTEPEAGLNG RALSYPRGRV LGGSSSINGM IYMRGQRGDY DDWARATGDA       120
     GWSWDSVLPV FRRSEDHHAG ATDMHGAGGM WRVEKQRLRW EILEAFSQAA QQTGIPATDD       180
     FNRGDNTGVG YFEVNQKRGI RWNASKAFLR PALARPNLTV ITGAQAERLV FDGKRCAGVE       240
     YRGGGAPFVA RARVEVLVAS GAVNSPQLLE LSGIGDGSRL QALGIGVVAD LRGVGENLQD       300
     HLQLRMAFRV RGVRTLNTLS AHWWGKLWIG AQYALMQRGP MSMAPSQLGA FAKSDPNDPA       360
     LAQPDLEYHV QPLSLERFGE PLHRFNAFTA SVCHLRPTSR GSVHAASPDP ARAPSIAPNY       420
     LSTDYDRHVA ANALRLTRRI ASAPALARYA PEEILPGARY VSEAELIAAA GAVGTTIFHP       480
     VGTCRMGRAD DPDAVVDSRL RVRGVTGLRI VDASVMPTIT SGNTNSPTLM IAERASDMIR       540
     ADRRGASERG ASARAEAVLP T                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page