(data stored in SCRATCH9089 zone)

EMBL: CP000124.BIOB

CP000124.BIOB        Location/Qualifiers
FT   CDS             complement(584097..585116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="BURPS1710b_0570"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50391"
FT                   /db_xref="GOA:Q3JWR8"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWR8"
FT                   /protein_id="ABA50391.1"
FT                   /translation="MTDMTEAQTACATTETPVAAPAAPRWRVADVIALYELPFNDLLFR
FT                   AQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAA
FT                   RTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGLETCVTLGMLEEHQAKALAE
FT                   AGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERA
FT                   GLIAQLANMNPYPESVPINNLVAIEGTPLANAQALDPFEFVRTIAVARITMPKAMVRLS
FT                   AGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLLARLGMWASEASQLSA"
     MTDMTEAQTA CATTETPVAA PAAPRWRVAD VIALYELPFN DLLFRAQQTH REHFDANAIQ        60
     LSTLLSIKTG GCEEDCGYCS QSAHHDTGLK AEKLMEVDAV LAAARTAKEN GATRFCMGAA       120
     WRNPKDRHIE PIKEMIRGVK DMGLETCVTL GMLEEHQAKA LAEAGLDYYN HNLDTSPEFY       180
     GQIISTRTYQ DRLDTLERVR DAGINVCCGG IIGMGESRRE RAGLIAQLAN MNPYPESVPI       240
     NNLVAIEGTP LANAQALDPF EFVRTIAVAR ITMPKAMVRL SAGREQLDDA MQALCFLAGA       300
     NSMFYGDVLL TTGNPRAEAD RKLLARLGMW ASEASQLSA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page