(data stored in SCRATCH9089 zone)

EMBL: CP000124.BPRA

CP000124.BPRA        Location/Qualifiers
FT   CDS             complement(50749..51126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0048"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49808"
FT                   /db_xref="GOA:Q3JY88"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY88"
FT                   /protein_id="ABA49808.1"
FT                   /translation="MTQLSEASLVKMASRPKIGAIWSDKREFMSSYKDLLAQREKLEKQ
FT                   IEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRPRAGVAAKYRDPESGAT
FT                   WSGRGKPPRWIAGKNREQFAI"
     MTQLSEASLV KMASRPKIGA IWSDKREFMS SYKDLLAQRE KLEKQIEEAK SREYAEVLSD        60
     VKQKIADYGF TLAELGLGRG KAGKAGRPRA GVAAKYRDPE SGATWSGRGK PPRWIAGKNR       120
     EQFAI                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page