(data stored in SCRATCH9089 zone)

EMBL: CP000124.CADA

CP000124.CADA        Location/Qualifiers
FT   CDS             complement(156986..159127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="BURPS1710b_0150"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48564"
FT                   /db_xref="GOA:Q3JXY7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY7"
FT                   /protein_id="ABA48564.1"
FT                   /translation="MRSAFRIMQMDCPTEETLIRKKLGAMSEVAALEFNLMQRMLAVEH
FT                   VPGAEAGIAAAIRSLGMTPEQADAGASGRGALPAPADAPRPWWPLAVAGVAAAASEAAT
FT                   WLQLPVWLAAALALAAVATCGLGTYRKGWIALTNGNLNINALMSIAVTGAMAIGQWPEA
FT                   AMVMVLFTVAELIEARSLDRARNAIQSLMRLAPDTVTLRQPDGTWQPVDAAQVALGAIV
FT                   RVKPGERIGLDGEIVAGRSTVNQAPITGESLPVEKTEGDAVYAGTINEAGSFEYRVTAV
FT                   ASNTTLARIIHAVEEAQGTKAPTQRFVDSFARVYTPIVFAIALVVAIAPPLVLDGAWRD
FT                   WIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEQGRRLAWLALDKT
FT                   GTITRGKPVQTDFEMRAADVDAALVRGLAARLAARSDHPVSQAVAAASAAQAGAGGAPR
FT                   AKPASFADVADFEAIPGRGVRGKIDGVPYWLGNHRLVEELDCCTSALEARLDELERQGK
FT                   TVVMLIDGARVLGLFAVADTVKDTSRAAVAELHALGIKTAMLTGDNPHTAQAIAQQVGI
FT                   DDARGNQLPQDKLAAVEALAAGGRAVGMVGDGINDAPALARADIGFAMGAMGTDTAIET
FT                   ADVALMDDDLRKIPAFVRLSRATHRVLVQNIAFALAVKAVFVGLTVAGMGTMWMAVFAD
FT                   AGASLIVVGNGLRLLRRGQ"
     MRSAFRIMQM DCPTEETLIR KKLGAMSEVA ALEFNLMQRM LAVEHVPGAE AGIAAAIRSL        60
     GMTPEQADAG ASGRGALPAP ADAPRPWWPL AVAGVAAAAS EAATWLQLPV WLAAALALAA       120
     VATCGLGTYR KGWIALTNGN LNINALMSIA VTGAMAIGQW PEAAMVMVLF TVAELIEARS       180
     LDRARNAIQS LMRLAPDTVT LRQPDGTWQP VDAAQVALGA IVRVKPGERI GLDGEIVAGR       240
     STVNQAPITG ESLPVEKTEG DAVYAGTINE AGSFEYRVTA VASNTTLARI IHAVEEAQGT       300
     KAPTQRFVDS FARVYTPIVF AIALVVAIAP PLVLDGAWRD WIYRALVLLV IACPCALVIS       360
     TPVTIVSGLA AAARRGILVK GGVYLEQGRR LAWLALDKTG TITRGKPVQT DFEMRAADVD       420
     AALVRGLAAR LAARSDHPVS QAVAAASAAQ AGAGGAPRAK PASFADVADF EAIPGRGVRG       480
     KIDGVPYWLG NHRLVEELDC CTSALEARLD ELERQGKTVV MLIDGARVLG LFAVADTVKD       540
     TSRAAVAELH ALGIKTAMLT GDNPHTAQAI AQQVGIDDAR GNQLPQDKLA AVEALAAGGR       600
     AVGMVGDGIN DAPALARADI GFAMGAMGTD TAIETADVAL MDDDLRKIPA FVRLSRATHR       660
     VLVQNIAFAL AVKAVFVGLT VAGMGTMWMA VFADAGASLI VVGNGLRLLR RGQ              713
//

If you have problems or comments...

PBIL Back to PBIL home page