(data stored in SCRATCH9089 zone)

EMBL: CP000124.CALB

CP000124.CALB        Location/Qualifiers
FT   CDS             complement(420547..421965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="calB"
FT                   /locus_tag="BURPS1710b_0409"
FT                   /product="coniferyl aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48328"
FT                   /db_xref="GOA:Q3JX80"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX80"
FT                   /protein_id="ABA48328.1"
FT                   /translation="MKNDLPGLATLDALLRDQRAAYLRAPYPSWATRADHLRALRKMLL
FT                   ENRDALAAAINADFGHRAKEEVLMSEIWLAKEEIDEALKHGKRWIKPKSRTMNKWLRPA
FT                   RAKVMPQPLGVVGIVVPWNYPVLLAAGPLICALAAGNRAIVKMSELTPRTSQLFEELIS
FT                   KTFARDHVAVVNGDAQIGAAFSGLPFDHLLFTGSTNVGRHVMRAAAEHLTPVTLELGGK
FT                   SPVIVGPRARFDAAVDAVITGKTLNAGQTCIAPDYVLVPRGKEAEFVARARARMARLYP
FT                   NLSTNPDYTSIISERHFARLQRLASEAQQAGAQLHPLTDAAPDPALRRLPPVLVTQAPD
FT                   ASQLMQEEIFGPLLPIVPYDTLDDAIAYVNARPRPLALYLFDEDRTTIERVMRDTISGG
FT                   VTVNDTLMHIACGTLPFGGVGASGMGAYHGYDGFVTFSKMKPVLTQPRLNTRAMIAPPY
FT                   GKRFAAILKLMLKF"
     MKNDLPGLAT LDALLRDQRA AYLRAPYPSW ATRADHLRAL RKMLLENRDA LAAAINADFG        60
     HRAKEEVLMS EIWLAKEEID EALKHGKRWI KPKSRTMNKW LRPARAKVMP QPLGVVGIVV       120
     PWNYPVLLAA GPLICALAAG NRAIVKMSEL TPRTSQLFEE LISKTFARDH VAVVNGDAQI       180
     GAAFSGLPFD HLLFTGSTNV GRHVMRAAAE HLTPVTLELG GKSPVIVGPR ARFDAAVDAV       240
     ITGKTLNAGQ TCIAPDYVLV PRGKEAEFVA RARARMARLY PNLSTNPDYT SIISERHFAR       300
     LQRLASEAQQ AGAQLHPLTD AAPDPALRRL PPVLVTQAPD ASQLMQEEIF GPLLPIVPYD       360
     TLDDAIAYVN ARPRPLALYL FDEDRTTIER VMRDTISGGV TVNDTLMHIA CGTLPFGGVG       420
     ASGMGAYHGY DGFVTFSKMK PVLTQPRLNT RAMIAPPYGK RFAAILKLML KF               472
//

If you have problems or comments...

PBIL Back to PBIL home page