(data stored in SCRATCH9089 zone)

EMBL: CP000124.CCA

CP000124.CCA         Location/Qualifiers
FT   CDS             467252..468550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="BURPS1710b_0457"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47724"
FT                   /db_xref="GOA:Q3JX32"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX32"
FT                   /protein_id="ABA47724.1"
FT                   /translation="MDRRRARRDARDRHLRAIAMKIYAVGGAIRDALLGLPVRDRDYVV
FT                   VGATPEQMAAQRFRPVGKDFPVFLHPDTHEEYALARTERKTAAGYHGFQFYYAPDVTLE
FT                   QDLVRRDLTINAMAREVSPDGALVGPVVDPFGGQADLRAKLFRHVGDAFVEDPVRILRV
FT                   ARFAARFAEFAVAPDTAALMRAMVDAGEVDALVPERVWQELARGLMEAKPSRMFAVLRE
FT                   CGALARILPEIDALFGVPQRADYHPEVDTGVHVMMVIDHAAKQGYSLAVRFAALTHDLG
FT                   KATTPADVLPRHIGHEGRSVDLLKPLCERLRVPNECRDLALVVAREHGNLHRVMEMGAA
FT                   ALVRLLERADALRKPARFAEALQASEADARGRLGLETKPYPQAERLRQALVAARAVDAG
FT                   AIAQGLAGEPAKIKDAVHRARVRAVAQAVGVAD"
     MDRRRARRDA RDRHLRAIAM KIYAVGGAIR DALLGLPVRD RDYVVVGATP EQMAAQRFRP        60
     VGKDFPVFLH PDTHEEYALA RTERKTAAGY HGFQFYYAPD VTLEQDLVRR DLTINAMARE       120
     VSPDGALVGP VVDPFGGQAD LRAKLFRHVG DAFVEDPVRI LRVARFAARF AEFAVAPDTA       180
     ALMRAMVDAG EVDALVPERV WQELARGLME AKPSRMFAVL RECGALARIL PEIDALFGVP       240
     QRADYHPEVD TGVHVMMVID HAAKQGYSLA VRFAALTHDL GKATTPADVL PRHIGHEGRS       300
     VDLLKPLCER LRVPNECRDL ALVVAREHGN LHRVMEMGAA ALVRLLERAD ALRKPARFAE       360
     ALQASEADAR GRLGLETKPY PQAERLRQAL VAARAVDAGA IAQGLAGEPA KIKDAVHRAR       420
     VRAVAQAVGV AD                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page