(data stored in SCRATCH9089 zone)

EMBL: CP000124.CHER

CP000124.CHER        Location/Qualifiers
FT   CDS             complement(75756..76700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="BURPS1710b_0073"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by match to protein family HMM PF01739;
FT                   match to protein family HMM PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51141"
FT                   /db_xref="GOA:Q3JY63"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY63"
FT                   /protein_id="ABA51141.1"
FT                   /translation="MPARAASRLDAPEPQERSGDAARDFEFTSADFTKIRALIHRRAGI
FT                   SLSEHKRDMAYSRLARRLRARGLNRFCDYLELLERENDPSEWEAFTNSLTTNLTAFFRE
FT                   SHHFPILAEFVKRREQPVSVWCSAASTGEEPYSIAMTLVEALGESAARSASVIATDLDT
FT                   QVLAKADAGVYAFEQVKHLSPERLKRFFLKGTGAQAGRVKVRPELRAMIRFAQLNLTDA
FT                   DYGLTKPFDAIFCRNVMIYFDKPTQSQVLARFEPLMKPGGLLFAGHSENFTYVTQAFRL
FT                   RGQTVYELTRDGQSAAPRVRARIAAAAAEEELR"
     MPARAASRLD APEPQERSGD AARDFEFTSA DFTKIRALIH RRAGISLSEH KRDMAYSRLA        60
     RRLRARGLNR FCDYLELLER ENDPSEWEAF TNSLTTNLTA FFRESHHFPI LAEFVKRREQ       120
     PVSVWCSAAS TGEEPYSIAM TLVEALGESA ARSASVIATD LDTQVLAKAD AGVYAFEQVK       180
     HLSPERLKRF FLKGTGAQAG RVKVRPELRA MIRFAQLNLT DADYGLTKPF DAIFCRNVMI       240
     YFDKPTQSQV LARFEPLMKP GGLLFAGHSE NFTYVTQAFR LRGQTVYELT RDGQSAAPRV       300
     RARIAAAAAE EELR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page