(data stored in SCRATCH9089 zone)

EMBL: CP000124.CHEY

CP000124.CHEY        Location/Qualifiers
FT   CDS             complement(73211..73777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BURPS1710b_0070"
FT                   /product="chemotaxis protein CheY"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47469"
FT                   /db_xref="GOA:Q3JY66"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY66"
FT                   /protein_id="ABA47469.1"
FT                   /translation="MRRPAGTRAGRRASPVWLGQTARLARCTTAGIARSRARDREPGLA
FT                   TVTEHESGKEQTMDKSMKILVVDDFPTMRRIVRNLLKELGYSNVDEAEDGLAGLARLRG
FT                   GGYDFVISDWNMPNLDGLAMLKEIRADASLTHLPVLMVTAESKKENIIAAAQAGASGYV
FT                   VKPFTAATLDEKLNKILEKMAKAGS"
     MRRPAGTRAG RRASPVWLGQ TARLARCTTA GIARSRARDR EPGLATVTEH ESGKEQTMDK        60
     SMKILVVDDF PTMRRIVRNL LKELGYSNVD EAEDGLAGLA RLRGGGYDFV ISDWNMPNLD       120
     GLAMLKEIRA DASLTHLPVL MVTAESKKEN IIAAAQAGAS GYVVKPFTAA TLDEKLNKIL       180
     EKMAKAGS                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page