(data stored in SCRATCH9089 zone)

EMBL: CP000124.DEHH

CP000124.DEHH        Location/Qualifiers
FT   CDS             543322..544272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehH"
FT                   /locus_tag="BURPS1710b_0537"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49286"
FT                   /db_xref="GOA:Q3JWV2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV2"
FT                   /protein_id="ABA49286.1"
FT                   /translation="MTRRSRSYNNETTIRENKTMSFEEFAPFRVTAQDVDIFGVKGGAG
FT                   PPILLLHGHPQTHMIWHRVAATLARHFTVIATDLRGYGASGKPPSDARHAPYSKRAMAA
FT                   DQVAVMRHFGFPRFYVCAHDRGARVAHRMALDHPDAVERMLLLDIAPTLAMYERTDRAF
FT                   ATAYFHWFFLIQPEPLPETLIGGQSDAYVEAVMGNRSAGLAPFSPEALHAYREALRQPG
FT                   AVHAMCEDYRASATIDLDHDRADLERGHKLACPLRVLWGEQGVVARCFEPLDEWRRVAR
FT                   DVSGRALACGHYIPEEAPVALIDEIVSFFEAREAA"
     MTRRSRSYNN ETTIRENKTM SFEEFAPFRV TAQDVDIFGV KGGAGPPILL LHGHPQTHMI        60
     WHRVAATLAR HFTVIATDLR GYGASGKPPS DARHAPYSKR AMAADQVAVM RHFGFPRFYV       120
     CAHDRGARVA HRMALDHPDA VERMLLLDIA PTLAMYERTD RAFATAYFHW FFLIQPEPLP       180
     ETLIGGQSDA YVEAVMGNRS AGLAPFSPEA LHAYREALRQ PGAVHAMCED YRASATIDLD       240
     HDRADLERGH KLACPLRVLW GEQGVVARCF EPLDEWRRVA RDVSGRALAC GHYIPEEAPV       300
     ALIDEIVSFF EAREAA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page