(data stored in SCRATCH9089 zone)

EMBL: CP000124.DKSA

CP000124.DKSA        Location/Qualifiers
FT   CDS             complement(403353..403769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="BURPS1710b_0387"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48600"
FT                   /db_xref="GOA:Q3JXA2"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA2"
FT                   /protein_id="ABA48600.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQAEILRNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIESGDYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
     MTKKLLTEAE ILKMSDKDYM NEDQLAFFKN RLEQLQAEIL RNAGQTTENL RETVIVPDPA        60
     DRATIEEEHA LELRTRDRER KLLKKVQQSL ARIESGDYGW CEETGEPIGI PRLLARPTAT       120
     LSLEAQERRE LRQKLFGD                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page