(data stored in SCRATCH9089 zone)

EMBL: CP000124.DNAA

CP000124.DNAA        Location/Qualifiers
FT   CDS             complement(310638..312239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BURPS1710b_0301"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49564"
FT                   /db_xref="GOA:Q3JXI6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXI6"
FT                   /protein_id="ABA49564.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAP
FT                   NRFKLDWVKSQFSGRISDLARDFWNAPIEVQFVLDPKAGQRSPAGATPLAPRAPLPSAN
FT                   PAPVAPGPASAPAVDAHAPAPAGMNAATAAAVAAAQAAQAAQANAAALNADEAADLDLP
FT                   SLTAHEAAAGRRTWRPGAANANSEAADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQ
FT                   VADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQ
FT                   RKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKE
FT                   ISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVSLSEDVAFFVAKHLRSNV
FT                   RELEGALRKILAYSKFHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVA
FT                   DMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKD
FT                   AQLNHELHVLEQTLKG"
     MNDFWQHCSA LLERELTPQQ YVTWIKPLAP VAFDAAANTL SIAAPNRFKL DWVKSQFSGR        60
     ISDLARDFWN APIEVQFVLD PKAGQRSPAG ATPLAPRAPL PSANPAPVAP GPASAPAVDA       120
     HAPAPAGMNA ATAAAVAAAQ AAQAAQANAA ALNADEAADL DLPSLTAHEA AAGRRTWRPG       180
     AANANSEAAD SMYERSKLNP VLTFDNFVTG KANQLARAAA IQVADNPGIS YNPLFLYGGV       240
     GLGKTHLIHA IGNQLLLDKP GARIRYIHAE QYVSDVVKAY QRKAFDDFKR YYHSLDLLLI       300
     DDIQFFSGKS RTQEEFFYAF EALVANKAQV IITSDTYPKE ISGIDDRLIS RFDSGLTVAI       360
     EPPELEMRVA ILMRKAQSEG VSLSEDVAFF VAKHLRSNVR ELEGALRKIL AYSKFHGREI       420
     TIELTKEALK DLLTVQNRQI SVENIQKTVA DFYNIKVADM YSKKRPANIA RPRQIAMYLA       480
     KELTQKSLPE IGELFGGRDH TTVLHAVRKI ADERGKDAQL NHELHVLEQT LKG              533
//

If you have problems or comments...

PBIL Back to PBIL home page