(data stored in SCRATCH9089 zone)

EMBL: CP000124.DNAN

CP000124.DNAN        Location/Qualifiers
FT   CDS             complement(309372..310475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BURPS1710b_0300"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50826"
FT                   /db_xref="GOA:Q3JXI7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI7"
FT                   /protein_id="ABA50826.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQSKDFGASLAVPQKAFRQLLGMVYFAMAQQDIRYYLNGMLLVV
FT                   DGDRLMAVATDGHRLAFSSMKIEGSFGRQEVIVPRKTILELQRLLEDIDDTVKIDIAQT
FT                   QAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRAAILTSDKFKG
FT                   VRCIIAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQVS
FT                   LGDASSSALITVPENDEFKYVVMPMRI"
     MQLVKTERDT LLRPLQTVSG IVERRHTLPI LANLLITKNG PDVSFLSTDL ELQITTRADF        60
     GVGGDQVATT VAARKLLDIL RAMPDGQVTL SLADKRLTVQ SGKSRFALQT LAADEFPTVA       120
     QSKDFGASLA VPQKAFRQLL GMVYFAMAQQ DIRYYLNGML LVVDGDRLMA VATDGHRLAF       180
     SSMKIEGSFG RQEVIVPRKT ILELQRLLED IDDTVKIDIA QTQAKFTFGQ VELVSKLVEG       240
     KFPDFQRVIP KAHKNTFEIG REELQRSLQR AAILTSDKFK GVRCIIAPGQ LKIMSTNADQ       300
     EEAQEELEIA YQGDTVDIGF NVTYLLDVLA NLKVDTVQVS LGDASSSALI TVPENDEFKY       360
     VVMPMRI                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page