(data stored in SCRATCH9089 zone)

EMBL: CP000124.DSBA

CP000124.DSBA        Location/Qualifiers
FT   CDS             complement(603999..604637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="BURPS1710b_0590"
FT                   /product="thiol:disulfide interchange protein"
FT                   /EC_number="5.3.4.1"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48407"
FT                   /db_xref="GOA:Q3JWP9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP9"
FT                   /protein_id="ABA48407.1"
FT                   /translation="MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPA
FT                   GKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIAFKRVPVAFRDDFVPHSKLFYALAA
FT                   LGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVKQSA
FT                   ELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL"
     MKKLLSSLFL SLSLVAGFAQ ASPSAPVAGK DFEVMKSPQP VSAPAGKVEV IEFFWYGCPH        60
     CYEFEPTIEA WVKKQGDKIA FKRVPVAFRD DFVPHSKLFY ALAALGVSEK VTPAVFNAIH       120
     KEKNYLLTPQ AQADFLATQG VDKKKFLDAY NSFSVQGQVK QSAELLKNYN IDGVPTIVVQ       180
     GKYKTGPAYT NSLEGTAQVL DFLVKQVQDK KL                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page