(data stored in SCRATCH9089 zone)

EMBL: CP000124.FADA

CP000124.FADA        Location/Qualifiers
FT   CDS             complement(591693..592886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="BURPS1710b_0579"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48979"
FT                   /db_xref="GOA:Q3JWR0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR0"
FT                   /protein_id="ABA48979.1"
FT                   /translation="MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALER
FT                   AGLQPEQIDEAVMGCVLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAH
FT                   DMLVAGSVDVIVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLM
FT                   GTFAEECAGEYAFSRDAQDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARD
FT                   EQPFKANPEKIPTLKPAFSKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVV
FT                   GHSTFAQAPSKFTTAPVGAIRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHE
FT                   KVNVNGGACALGHPIGASGARILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI"
     MTAVDQDPIV IASAARTPIA GFQGEFASLA APQLGAAAIA AALERAGLQP EQIDEAVMGC        60
     VLPAGQGQAP ARQAALGAKL PLSVGCTTIN KMCGSGMRAA MFAHDMLVAG SVDVIVAGGM       120
     ESMTNAPYLL PKARAGMRMG HGQVLDHMFL DGLEDAYDKG RLMGTFAEEC AGEYAFSRDA       180
     QDAFAIESLA RAKRANEDGS FAWEIAPVTV AGKKGDAVIA RDEQPFKANP EKIPTLKPAF       240
     SKTGTVTAAN SSSISDGAAA LVMMRASTAN RLGLAPLARV VGHSTFAQAP SKFTTAPVGA       300
     IRRLFEKNGW RAAEVDLYEI NEAFAVVTMA AMKEHGLPHE KVNVNGGACA LGHPIGASGA       360
     RILVTLIGAL RARGAKRGVA SLCIGGGEAT AMGIELI                                397
//

If you have problems or comments...

PBIL Back to PBIL home page