(data stored in SCRATCH9089 zone)

EMBL: CP000124.FCS

CP000124.FCS         Location/Qualifiers
FT   CDS             166914..168461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcs"
FT                   /locus_tag="BURPS1710b_0163"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47789"
FT                   /db_xref="GOA:Q3JXX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX4"
FT                   /protein_id="ABA47789.1"
FT                   /translation="MNLIAALERAARATPDKPFLRDDGATLTYRQMQQRSRRAAEVLAS
FT                   LGVAPGERVAAMCLNTPAFFDLLLGAWCIGAVVVPVNHKLQAPEVDHILRHSASRAVLF
FT                   DAALAPVLANVEHDALRLATEGEAAGAAPFDRLVADAAGIAPATPDDAALAEILYTSGT
FT                   TGRPKGCMHSHRTVALAAATSALALSMTERERTLMAMPVWHASPLNNWFGGTLYVGGTV
FT                   VLMREYQPLRFLQTVEAEQVTLYFGAPVSYTLPLDTIADFASFDLTSVRAWLYGGGPIG
FT                   ATLARRLMRAYRSEAFYQVYGMTETGPAGTVLHPFEQAMKPGSIGCQGTPGVDVRVVTA
FT                   AGGLARPGEIGEIRLRADSMMLGYLDDPGATRAAFDDDGWYRSGDVARVDDDGYLFVVD
FT                   RIKDMIVTGGENVYSKEVEDVLNAHPAVAEAAVVGRAHPEWGETVIAHVVLREAAGAAR
FT                   AGQAESAAGVDADALRAFCATRLAAYKIPREYVFAERLPRTPTGKLQKYLLRARGGA"
     MNLIAALERA ARATPDKPFL RDDGATLTYR QMQQRSRRAA EVLASLGVAP GERVAAMCLN        60
     TPAFFDLLLG AWCIGAVVVP VNHKLQAPEV DHILRHSASR AVLFDAALAP VLANVEHDAL       120
     RLATEGEAAG AAPFDRLVAD AAGIAPATPD DAALAEILYT SGTTGRPKGC MHSHRTVALA       180
     AATSALALSM TERERTLMAM PVWHASPLNN WFGGTLYVGG TVVLMREYQP LRFLQTVEAE       240
     QVTLYFGAPV SYTLPLDTIA DFASFDLTSV RAWLYGGGPI GATLARRLMR AYRSEAFYQV       300
     YGMTETGPAG TVLHPFEQAM KPGSIGCQGT PGVDVRVVTA AGGLARPGEI GEIRLRADSM       360
     MLGYLDDPGA TRAAFDDDGW YRSGDVARVD DDGYLFVVDR IKDMIVTGGE NVYSKEVEDV       420
     LNAHPAVAEA AVVGRAHPEW GETVIAHVVL REAAGAARAG QAESAAGVDA DALRAFCATR       480
     LAAYKIPREY VFAERLPRTP TGKLQKYLLR ARGGA                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page