(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGB

CP000124.FLGB        Location/Qualifiers
FT   CDS             472656..473147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BURPS1710b_0462"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48186"
FT                   /db_xref="GOA:Q3JX27"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX27"
FT                   /protein_id="ABA48186.1"
FT                   /translation="MLDKLDAEFAFGRQALDVRAYRQELLSSNIANADTPGYRARDVDF
FT                   SSTLARALKQDGAASAGNAAQLPLAQPAGVASGMSMATTSGAHLAGNVKLIPTGGPSDD
FT                   YGRAQYRIPQQPALDGNTVDLDTERVQFADNAVHYQAGMTVMTQQIKTMIAAITSNSSS
FT                   "
     MLDKLDAEFA FGRQALDVRA YRQELLSSNI ANADTPGYRA RDVDFSSTLA RALKQDGAAS        60
     AGNAAQLPLA QPAGVASGMS MATTSGAHLA GNVKLIPTGG PSDDYGRAQY RIPQQPALDG       120
     NTVDLDTERV QFADNAVHYQ AGMTVMTQQI KTMIAAITSN SSS                         163
//

If you have problems or comments...

PBIL Back to PBIL home page