(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGD

CP000124.FLGD        Location/Qualifiers
FT   CDS             473173..474552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="BURPS1710b_0464"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50945"
FT                   /db_xref="GOA:Q3JX26"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX26"
FT                   /protein_id="ABA50945.1"
FT                   /translation="MPRASRETVECARNAIRSTHAFVDEHFRRRGFRDVGPVAAPERHG
FT                   VEPRERRQRDGPRRQALQGEAGGVRDRADGPRAHRVRPGCRRRAGEQGDRRSVADEDGL
FT                   RPVEPGRRSERLRDDAERRSGAGDGQHDFRVALVPGERRDAQYREAADAQDADDRQLTP
FT                   PFFIDRNTHSRGRRTRMTSSFTTIGGSGTTVNSLPYDTMSSNGQSSGTSGANTTNGTAG
FT                   TNGTSGANSGINVASSLSTTSAADLQTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQIN
FT                   TVSGIAQLNTALTSLSSQLTAGQQTQAAMLIGSNVLAPGNTVPVKSGAASPFGVQLTSA
FT                   VSNLTITVKNASGVVVNTINAGAQSAGTVPFNWTPTDTAGNKLPDGTYTISASYTDTSG
FT                   KQYAPTTLSSAQVLSVIKQADGTPGLVLSNGSTVGFSQVASIFPNTTKSASTGNASSST
FT                   N"
     MPRASRETVE CARNAIRSTH AFVDEHFRRR GFRDVGPVAA PERHGVEPRE RRQRDGPRRQ        60
     ALQGEAGGVR DRADGPRAHR VRPGCRRRAG EQGDRRSVAD EDGLRPVEPG RRSERLRDDA       120
     ERRSGAGDGQ HDFRVALVPG ERRDAQYREA ADAQDADDRQ LTPPFFIDRN THSRGRRTRM       180
     TSSFTTIGGS GTTVNSLPYD TMSSNGQSSG TSGANTTNGT AGTNGTSGAN SGINVASSLS       240
     TTSAADLQTT FLKLLVTQLQ NQDPTSPVDS SQMTSQLAQI NTVSGIAQLN TALTSLSSQL       300
     TAGQQTQAAM LIGSNVLAPG NTVPVKSGAA SPFGVQLTSA VSNLTITVKN ASGVVVNTIN       360
     AGAQSAGTVP FNWTPTDTAG NKLPDGTYTI SASYTDTSGK QYAPTTLSSA QVLSVIKQAD       420
     GTPGLVLSNG STVGFSQVAS IFPNTTKSAS TGNASSSTN                              459
//

If you have problems or comments...

PBIL Back to PBIL home page