(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGI

CP000124.FLGI        Location/Qualifiers
FT   CDS             478264..479373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="BURPS1710b_0469"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48991"
FT                   /db_xref="GOA:Q3JX19"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX19"
FT                   /protein_id="ABA48991.1"
FT                   /translation="MLALAFAPAAARAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQ
FT                   TMQTPFTTQTLANMLANLGISINNGSANGGGSSAMTNMQLKNVAAVMVTATLPPFARPG
FT                   EAIDVTVSSLGNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQ
FT                   LAAGRIAGGAIVERSVPNAVAQMNGVLQLQLNDMDYGTAQRIVSAVNSSFGAGTATALD
FT                   GRTIQLTAPADSAQQVAFMARLQNLEVSPERAAAKVILNARTGSIVMNQMVTLQNCAVA
FT                   HGNLSVVVNTQPVVSQPGPFSNGQTVVAQQSQIQLKQDNGSLRMVTAGANLADVVKALN
FT                   SLGATPADLMSILQAMKAAGALRADLEII"
     MLALAFAPAA ARAERLKDLA QIQGVRDNPL IGYGLVVGLD GTGDQTMQTP FTTQTLANML        60
     ANLGISINNG SANGGGSSAM TNMQLKNVAA VMVTATLPPF ARPGEAIDVT VSSLGNAKSL       120
     RGGTLLLTPL KGADGQVYAL AQGNMAVGGA GASANGSRVQ VNQLAAGRIA GGAIVERSVP       180
     NAVAQMNGVL QLQLNDMDYG TAQRIVSAVN SSFGAGTATA LDGRTIQLTA PADSAQQVAF       240
     MARLQNLEVS PERAAAKVIL NARTGSIVMN QMVTLQNCAV AHGNLSVVVN TQPVVSQPGP       300
     FSNGQTVVAQ QSQIQLKQDN GSLRMVTAGA NLADVVKALN SLGATPADLM SILQAMKAAG       360
     ALRADLEII                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page