(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGK

CP000124.FLGK        Location/Qualifiers
FT   CDS             481478..483481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="BURPS1710b_0473"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="identified by match to protein family HMM PF06429;
FT                   match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48595"
FT                   /db_xref="GOA:Q3JX15"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX15"
FT                   /protein_id="ABA48595.1"
FT                   /translation="MSNTLMNLGVSGLNAALWGLTTTGQNISNAATPGYSVERPVYAEA
FT                   SGQYTSSGYLPQGVSTVTVERQYNQYLSNQLNAAQTQGSSLSTYYTLVAQLNNYVGSPT
FT                   AGIATAITNYFTGLQTVANNAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQL
FT                   TDTVTQINSYTSQIAQLNEQIASASSQGQPPNQLLDQRDLAVSKLSQLAGVQVVQSNGN
FT                   YSVFLSGGQPLVVGNASYQLATVASPSDPSELTIVSKGVAGSAQPGPTQYLPDVSLTGG
FT                   ALGGLLAFRSQTLDPAQAQLGALAVSFASQVNAQNALGVDMSGNPGGSLFAVGAPAVYA
FT                   NQNNTGSATLSVSFVDGTQPTTSDYALSYDGAKYTLTDRATGSVVGTATPSSTPPTMTI
FT                   GGLKLSLSSTPNAGDSFTVLPTRGALDGFSLAIANGSAIAAASPVLAAGVATNSGTGVI
FT                   SQGSVSAGYQLPSGTTTLAYNAASKTLSGFPVGTTVTIAGTPPTSINITSATTPVPYDP
FT                   SKGASMTISSTTQPAPSGVMNGVSVSLSGTPADGDQFTIGANKGTNDGRNALALSQLVN
FT                   SKTMNNGTTTLTGAYAGYVNAIGNAASQLKASSAAQTALVGQITQAQQSVSGVNQNEEA
FT                   ANLMQYQQLYQANAKVIQTANSVFQTVLGLFN"
     MSNTLMNLGV SGLNAALWGL TTTGQNISNA ATPGYSVERP VYAEASGQYT SSGYLPQGVS        60
     TVTVERQYNQ YLSNQLNAAQ TQGSSLSTYY TLVAQLNNYV GSPTAGIATA ITNYFTGLQT       120
     VANNAADPSA RQTAMSNAQT LASQLVAAGQ QYSQLRQSVN SQLTDTVTQI NSYTSQIAQL       180
     NEQIASASSQ GQPPNQLLDQ RDLAVSKLSQ LAGVQVVQSN GNYSVFLSGG QPLVVGNASY       240
     QLATVASPSD PSELTIVSKG VAGSAQPGPT QYLPDVSLTG GALGGLLAFR SQTLDPAQAQ       300
     LGALAVSFAS QVNAQNALGV DMSGNPGGSL FAVGAPAVYA NQNNTGSATL SVSFVDGTQP       360
     TTSDYALSYD GAKYTLTDRA TGSVVGTATP SSTPPTMTIG GLKLSLSSTP NAGDSFTVLP       420
     TRGALDGFSL AIANGSAIAA ASPVLAAGVA TNSGTGVISQ GSVSAGYQLP SGTTTLAYNA       480
     ASKTLSGFPV GTTVTIAGTP PTSINITSAT TPVPYDPSKG ASMTISSTTQ PAPSGVMNGV       540
     SVSLSGTPAD GDQFTIGANK GTNDGRNALA LSQLVNSKTM NNGTTTLTGA YAGYVNAIGN       600
     AASQLKASSA AQTALVGQIT QAQQSVSGVN QNEEAANLMQ YQQLYQANAK VIQTANSVFQ       660
     TVLGLFN                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page