(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGL

CP000124.FLGL        Location/Qualifiers
FT   CDS             483539..484729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="BURPS1710b_0475"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48925"
FT                   /db_xref="GOA:Q3JX14"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX14"
FT                   /protein_id="ABA48925.1"
FT                   /translation="MMNDQQAQIAQLYQQVSSGISLTTPADNPLAAAQAVQLSATSATL
FT                   AQYTQNQTIVQTALQTEDTTLTSVNDVLNAAYQALMHAGDGGLSDSDRAALAAQIQGSR
FT                   DHLLTLANTADGAGNYLFAGFQPTTQPFSNKPGGGVTYAGDYGARAVQIADTRTVSQGD
FT                   NGANVFMSVPFLGSLPVPAAGASNTGTGTIGAVSITNPSDPTNTHQFTITFGGTAAAPT
FT                   YTVTDNSVTPPTTTAAQAYSSGQGINLGGQTVAVSGKPAVGDTFTVTPAPQAGTDVFAT
FT                   LDTVIAALKSPVGNSQTASTALTNTMATASTKLMNTMTNVLTVQASVGGRLQEVKAMQA
FT                   VTTTNTLQTTNSLSNLTDTNLPAAISQFLQLQNSLSAAQKAFVQMQNLSLFQYLNP"
     MMNDQQAQIA QLYQQVSSGI SLTTPADNPL AAAQAVQLSA TSATLAQYTQ NQTIVQTALQ        60
     TEDTTLTSVN DVLNAAYQAL MHAGDGGLSD SDRAALAAQI QGSRDHLLTL ANTADGAGNY       120
     LFAGFQPTTQ PFSNKPGGGV TYAGDYGARA VQIADTRTVS QGDNGANVFM SVPFLGSLPV       180
     PAAGASNTGT GTIGAVSITN PSDPTNTHQF TITFGGTAAA PTYTVTDNSV TPPTTTAAQA       240
     YSSGQGINLG GQTVAVSGKP AVGDTFTVTP APQAGTDVFA TLDTVIAALK SPVGNSQTAS       300
     TALTNTMATA STKLMNTMTN VLTVQASVGG RLQEVKAMQA VTTTNTLQTT NSLSNLTDTN       360
     LPAAISQFLQ LQNSLSAAQK AFVQMQNLSL FQYLNP                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page