(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGM

CP000124.FLGM        Location/Qualifiers
FT   CDS             complement(470419..470763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="BURPS1710b_0460"
FT                   /product="negative regulator of flagellin synthesis"
FT                   /note="identified by match to protein family HMM PF04316"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49507"
FT                   /db_xref="GOA:Q3JX29"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX29"
FT                   /protein_id="ABA49507.1"
FT                   /translation="MKVDSTPTSNARTLSNASAGAARTQAGQPAAAQTPAGAAGAPTGG
FT                   DANVSLSGLSSTLRSLAASGSADIDTAQVDAIRDAIKSGTLSIDTGKIADGILQTARDL
FT                   LKQPSQAGNR"
     MKVDSTPTSN ARTLSNASAG AARTQAGQPA AAQTPAGAAG APTGGDANVS LSGLSSTLRS        60
     LAASGSADID TAQVDAIRDA IKSGTLSIDT GKIADGILQT ARDLLKQPSQ AGNR             114
//

If you have problems or comments...

PBIL Back to PBIL home page