(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLHA

CP000124.FLHA        Location/Qualifiers
FT   CDS             complement(65754..67856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BURPS1710b_0062"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01398"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50390"
FT                   /db_xref="GOA:Q3JY74"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY74"
FT                   /protein_id="ABA50390.1"
FT                   /translation="MNMPAGLLGKRAQLFAGTNLRALAGPILICMILGMMILPLPPLLL
FT                   DLFFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEGHTG
FT                   PDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFMVITKGAGRIAEVSARFTLDAMPG
FT                   KQMAIDADLNAGLINEEQAKKRRQSVAQEAEFYGSMDGASKFVRGDAIAGLIIMAINVI
FT                   GGLIVGMAQHDMSFAAAGKNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATDEDIGTQ
FT                   LTTQLFTNPRVLMITGSIIVLMGLIPNMPHFAFLLLGGGAIWLSRTMTKREAAKKAAGM
FT                   VAEIAPPAALPADSHEATWEDVTLIDPLGLEVGYRLIPLVDKNADGELLKRIKSIRKKF
FT                   AQEIGFLPPVIHIRDNLELRPNAYRIALKGVEVGTGEAYPGQWLAINPGQVTAALPGAP
FT                   TQDPAFGLPAVWIDTALREQAQVYGYTVVDASTVVATHLNHLVVQHAAELLGRQEVQAL
FT                   IERTGKDAPSLVEDLVPKTISLTTLQKVLQNLLDEGVPIRDMRTIIEAVSEQAGRITDP
FT                   YDLTAAVRLSLGRAITQQWYPGAGEMQVMGLDANLERVLSQALATGANPGLEPGLAHSL
FT                   LIGTQDAMLRQQNMGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYAEVPDTRTIKVVN
FT                   VIGGTA"
     MNMPAGLLGK RAQLFAGTNL RALAGPILIC MILGMMILPL PPLLLDLFFT FNIALSVMVL        60
     LVSMYTMKPL DFAAFPSVLL FSTLLRLSLN VASTRVVLLE GHTGPDAAGQ VIEAFGHFLV       120
     GGNFAVGIVV FVILMIINFM VITKGAGRIA EVSARFTLDA MPGKQMAIDA DLNAGLINEE       180
     QAKKRRQSVA QEAEFYGSMD GASKFVRGDA IAGLIIMAIN VIGGLIVGMA QHDMSFAAAG       240
     KNYTLLTIGD GLVAQIPSLV ISTAAGVIVS RVATDEDIGT QLTTQLFTNP RVLMITGSII       300
     VLMGLIPNMP HFAFLLLGGG AIWLSRTMTK REAAKKAAGM VAEIAPPAAL PADSHEATWE       360
     DVTLIDPLGL EVGYRLIPLV DKNADGELLK RIKSIRKKFA QEIGFLPPVI HIRDNLELRP       420
     NAYRIALKGV EVGTGEAYPG QWLAINPGQV TAALPGAPTQ DPAFGLPAVW IDTALREQAQ       480
     VYGYTVVDAS TVVATHLNHL VVQHAAELLG RQEVQALIER TGKDAPSLVE DLVPKTISLT       540
     TLQKVLQNLL DEGVPIRDMR TIIEAVSEQA GRITDPYDLT AAVRLSLGRA ITQQWYPGAG       600
     EMQVMGLDAN LERVLSQALA TGANPGLEPG LAHSLLIGTQ DAMLRQQNMG LPPVLLVQHA       660
     LRAMLARFLR RSLPQLKVLS YAEVPDTRTI KVVNVIGGTA                             700
//

If you have problems or comments...

PBIL Back to PBIL home page