(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLHB

CP000124.FLHB        Location/Qualifiers
FT   CDS             complement(67853..69265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BURPS1710b_0063"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR00328"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50940"
FT                   /db_xref="GOA:Q3JY73"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY73"
FT                   /protein_id="ABA50940.1"
FT                   /translation="MLRVSLFPPAACAAHRAPKIPPPPPFACATDSEKYPGFPAFLDRS
FT                   PVDRRGNNRCHWKAASRRAHMEARVAEDSDLDRTEAATPKRREKAREEGQVARSRELAS
FT                   FALLSAGFYGAWMLSGPIGEHLRTMLHTAFSFDRAAAFDTNRMLSHAGTLSLEGLYALA
FT                   PVLALTGVAALAAPMAMGGWLVSTKTFELKFERLNPITGLGRIFSIQGPIQLGMSIAKT
FT                   LVVGGIGGIAIWRSKDELLGLATQPLHAALADALHLVAVCCGMTVAGMLVVAGLDVPYQ
FT                   LWQYNKKLRMTKEEIKREHRENEGDPHVKGRIRQQQRAMARRRMMANVPTADVVVTNPT
FT                   HFAVALKYTDGEMRAPKVVAKGVNLVAARIRELAAEHHVPLLEAPPLARALYHNVELER
FT                   EIPGTLYSAVAEVLAWVYQLKRFRAEAGIAPETPVDLDVPAELDKGAHVAPQDEREEAE
FT                   DALGGRAAGGAA"
     MLRVSLFPPA ACAAHRAPKI PPPPPFACAT DSEKYPGFPA FLDRSPVDRR GNNRCHWKAA        60
     SRRAHMEARV AEDSDLDRTE AATPKRREKA REEGQVARSR ELASFALLSA GFYGAWMLSG       120
     PIGEHLRTML HTAFSFDRAA AFDTNRMLSH AGTLSLEGLY ALAPVLALTG VAALAAPMAM       180
     GGWLVSTKTF ELKFERLNPI TGLGRIFSIQ GPIQLGMSIA KTLVVGGIGG IAIWRSKDEL       240
     LGLATQPLHA ALADALHLVA VCCGMTVAGM LVVAGLDVPY QLWQYNKKLR MTKEEIKREH       300
     RENEGDPHVK GRIRQQQRAM ARRRMMANVP TADVVVTNPT HFAVALKYTD GEMRAPKVVA       360
     KGVNLVAARI RELAAEHHVP LLEAPPLARA LYHNVELERE IPGTLYSAVA EVLAWVYQLK       420
     RFRAEAGIAP ETPVDLDVPA ELDKGAHVAP QDEREEAEDA LGGRAAGGAA                  470
//

If you have problems or comments...

PBIL Back to PBIL home page