(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLHD

CP000124.FLHD        Location/Qualifiers
FT   CDS             complement(84805..85473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhD"
FT                   /locus_tag="BURPS1710b_0082"
FT                   /product="FlhD"
FT                   /note="identified by match to protein family HMM PF05247"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48191"
FT                   /db_xref="GOA:Q3JY54"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY54"
FT                   /protein_id="ABA48191.1"
FT                   /translation="MAEKECESRAPQWRALRPHAVLAPEGDVFPALIGGAFGRPGVRRR
FT                   FPPFVGKIPTRFTDNSGKAHSPSLIAAPPSIGQNARKNINKPIAPFAVGRSSKRFHWHY
FT                   RLAKDFLRGNRIMSATSEMLAEINEVNLSYLLLAQRLLREDKAMGMFRMGISEELADVL
FT                   ANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSSAVSHAHSAILMAGQPVESLR
FT                   "
     MAEKECESRA PQWRALRPHA VLAPEGDVFP ALIGGAFGRP GVRRRFPPFV GKIPTRFTDN        60
     SGKAHSPSLI AAPPSIGQNA RKNINKPIAP FAVGRSSKRF HWHYRLAKDF LRGNRIMSAT       120
     SEMLAEINEV NLSYLLLAQR LLREDKAMGM FRMGISEELA DVLANLTLAQ TVKLAASNQM       180
     LCRFRFDDHA LLSSLADKGR SSAVSHAHSA ILMAGQPVES LR                          222
//

If you have problems or comments...

PBIL Back to PBIL home page