(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLHF

CP000124.FLHF        Location/Qualifiers
FT   CDS             complement(64006..65757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="BURPS1710b_0061"
FT                   /product="flagellar biosynthesis protein FlhF"
FT                   /note="identified by match to protein family HMM PF00448"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49221"
FT                   /db_xref="GOA:Q3JY75"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY75"
FT                   /protein_id="ABA49221.1"
FT                   /translation="MNIRKFIGPTSRDALRLVREAMGADAAVLSNRTLEDGRVEIVALP
FT                   AAELAEISTRRAADAAHGAAQPHAPRQGAQHAPSGPSFASPAASVVVPSAASGASAPAS
FT                   RAAANPYAAGGMPDVFSSVFGASVDASADDDARPAVSPPVPPALPPAAPSEPAPWLVEH
FT                   AKRLTKQHEELIARPRATAALPAQNAPQAPRERASADEAPEWARDIVRNAARRLPADEP
FT                   AAAKPALRLPEDTAAAVADAVKARIERIVNDTVMQELGSLRELMEEQFAGLMWNERQRR
FT                   NPVHGALTKYLFAAGFSAQLVRMIVDNLPEGEGYDTLDAAADWAQSVLAANLPVLDSED
FT                   ALMERGGVFALMGPTGVGKTTTTAKLAARCVMRFGASKVALLTTDSYRIGGHEQLRIFG
FT                   KILGVPVHAVKDGGDLQLALAELRNKHMVLIDTIGMSQRDRTVSDQIAMLHGADTPVQR
FT                   LLLLNATSHGDTLNEVVQAYRSAAGQPKAALPDLAGCILTKLDEASNLGGVLDTVIRYK
FT                   LPVHYVSTGQKVPENLYVATKKFLLKSAFCAPREDSPFVPHDDDLPAMLSALSTRTGNE
FT                   LHEVRFG"
     MNIRKFIGPT SRDALRLVRE AMGADAAVLS NRTLEDGRVE IVALPAAELA EISTRRAADA        60
     AHGAAQPHAP RQGAQHAPSG PSFASPAASV VVPSAASGAS APASRAAANP YAAGGMPDVF       120
     SSVFGASVDA SADDDARPAV SPPVPPALPP AAPSEPAPWL VEHAKRLTKQ HEELIARPRA       180
     TAALPAQNAP QAPRERASAD EAPEWARDIV RNAARRLPAD EPAAAKPALR LPEDTAAAVA       240
     DAVKARIERI VNDTVMQELG SLRELMEEQF AGLMWNERQR RNPVHGALTK YLFAAGFSAQ       300
     LVRMIVDNLP EGEGYDTLDA AADWAQSVLA ANLPVLDSED ALMERGGVFA LMGPTGVGKT       360
     TTTAKLAARC VMRFGASKVA LLTTDSYRIG GHEQLRIFGK ILGVPVHAVK DGGDLQLALA       420
     ELRNKHMVLI DTIGMSQRDR TVSDQIAMLH GADTPVQRLL LLNATSHGDT LNEVVQAYRS       480
     AAGQPKAALP DLAGCILTKL DEASNLGGVL DTVIRYKLPV HYVSTGQKVP ENLYVATKKF       540
     LLKSAFCAPR EDSPFVPHDD DLPAMLSALS TRTGNELHEV RFG                         583
//

If you have problems or comments...

PBIL Back to PBIL home page