(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLIC

CP000124.FLIC        Location/Qualifiers
FT   CDS             91845..93293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="BURPS1710b_0090"
FT                   /product="flagellin"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48561"
FT                   /db_xref="GOA:Q3JY46"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR022578"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY46"
FT                   /protein_id="ABA48561.1"
FT                   /translation="MVYRFSARAIRVHARSRRLAGRRTARRSHARFVRIQRWLTERSTQ
FT                   KIRAESRPAPSSFFGVRRNPAQGGRQRTSASARANSGIDGLIQLNLEIFMLGINSNINS
FT                   LVAQQNLNGSQGALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGLNQGVSNAND
FT                   GVSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQISEVNRIASQ
FT                   TNYNGKNILDGSAGTLSFQVGANVGQTVSVDLTQSMSAAKIGGGMVQTGQTLGTIKVAI
FT                   DSSGAAWSSGSTGQETTQINVVSDGKGGFTFTDQNNQALSSTAVTAVFGSSTAGTGTAA
FT                   SPSFQTLALSTSATSALSATDQANATAMVAQINAVNKPQTVSNLDISTQTGAYQAMVSI
FT                   DNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSADFAQETANLSRAQV
FT                   LQQAGISVLAQANSLPQQVLKLLQ"
     MVYRFSARAI RVHARSRRLA GRRTARRSHA RFVRIQRWLT ERSTQKIRAE SRPAPSSFFG        60
     VRRNPAQGGR QRTSASARAN SGIDGLIQLN LEIFMLGINS NINSLVAQQN LNGSQGALSQ       120
     AITRLSSGKR INSAADDAAG LAIATRMQTQ INGLNQGVSN ANDGVSILQT ASSGLTSLTN       180
     SLQRIRQLAV QASNGPLSAS DASALQQEVA QQISEVNRIA SQTNYNGKNI LDGSAGTLSF       240
     QVGANVGQTV SVDLTQSMSA AKIGGGMVQT GQTLGTIKVA IDSSGAAWSS GSTGQETTQI       300
     NVVSDGKGGF TFTDQNNQAL SSTAVTAVFG SSTAGTGTAA SPSFQTLALS TSATSALSAT       360
     DQANATAMVA QINAVNKPQT VSNLDISTQT GAYQAMVSID NALATVNNLQ ATLGAAQNRF       420
     TAIATTQQAG SNNLAQAQSQ IQSADFAQET ANLSRAQVLQ QAGISVLAQA NSLPQQVLKL       480
     LQ                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page