(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLID

CP000124.FLID        Location/Qualifiers
FT   CDS             93443..94963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="BURPS1710b_0092"
FT                   /product="flagellar hook-associated protein"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47553"
FT                   /db_xref="GOA:Q3JY44"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY44"
FT                   /protein_id="ABA47553.1"
FT                   /translation="MSTPVTSTTQQQTNSALQQAAQSIISGSTGNSSMDVNSLVTALVN
FT                   AKTAGQSAALSTSIATDQTTLSALGTLKAALTALQAGIGSLSDGTLTQKFTATATGTGL
FT                   TATTGAGAVAGSYSVAVTQIATSQTLSSGAFNATQQLGTGTLTLSVGGKSTSISIDSTN
FT                   NTLSGIAAAINSASNNPGVTATIVTGTDGAHLVLRSASTGAANVINVGVSNLSGDNGLS
FT                   SLAVTSTASTTGGQSTIRSGGSVAWTQSTSAQDAEFTVGGIAASSASNAVSGAIAGVTL
FT                   NLTQAAVGATQTLNVTTDTTAQATAITNVVNLYNTVITTMSSLSSLSGAGTSSQSAGPL
FT                   LGDSTLNMIRNSLARVVGAGVTTGGSTTSLASIGIKFADGSSSSQTDGALTIDTAKLNA
FT                   ALQNSPSTVAALFNSTNGIGAQLNTTIQNYVQTGGVFDTRSNALNQDLKSLAQQQTRLA
FT                   SYASQLTSQYNAQFTALNTLMAQMNSNSNYLTQLFGGSNSSGAMANNK"
     MSTPVTSTTQ QQTNSALQQA AQSIISGSTG NSSMDVNSLV TALVNAKTAG QSAALSTSIA        60
     TDQTTLSALG TLKAALTALQ AGIGSLSDGT LTQKFTATAT GTGLTATTGA GAVAGSYSVA       120
     VTQIATSQTL SSGAFNATQQ LGTGTLTLSV GGKSTSISID STNNTLSGIA AAINSASNNP       180
     GVTATIVTGT DGAHLVLRSA STGAANVINV GVSNLSGDNG LSSLAVTSTA STTGGQSTIR       240
     SGGSVAWTQS TSAQDAEFTV GGIAASSASN AVSGAIAGVT LNLTQAAVGA TQTLNVTTDT       300
     TAQATAITNV VNLYNTVITT MSSLSSLSGA GTSSQSAGPL LGDSTLNMIR NSLARVVGAG       360
     VTTGGSTTSL ASIGIKFADG SSSSQTDGAL TIDTAKLNAA LQNSPSTVAA LFNSTNGIGA       420
     QLNTTIQNYV QTGGVFDTRS NALNQDLKSL AQQQTRLASY ASQLTSQYNA QFTALNTLMA       480
     QMNSNSNYLT QLFGGSNSSG AMANNK                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page