(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLIP

CP000124.FLIP        Location/Qualifiers
FT   CDS             253610..254440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BURPS1710b_0243"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49592"
FT                   /db_xref="GOA:Q3JXP4"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP4"
FT                   /protein_id="ABA49592.1"
FT                   /translation="MPRLRFVAPRADAAACAPSDSRSMKTACLRGAARWLPAILIGLAP
FT                   ALACAQAAGLPAFNSAPGSNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLS
FT                   LLRQAIGTASTPPNQVLVGLALFLTLFVMSPVLDRAYNDAYKPFSEGTLQMDQAVQRGT
FT                   APFKAFMLKQTRETDLALFAKISKAAPMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIF
FT                   IPFLIIDMVVASVLMSMGMMMVSPATVSLPFKLMLFVLVDGWQLLIGSLAQSFT"
     MPRLRFVAPR ADAAACAPSD SRSMKTACLR GAARWLPAIL IGLAPALACA QAAGLPAFNS        60
     APGSNGGTTY SLSVQTMLLL TMLSFLPAML LMMTSFTRII IVLSLLRQAI GTASTPPNQV       120
     LVGLALFLTL FVMSPVLDRA YNDAYKPFSE GTLQMDQAVQ RGTAPFKAFM LKQTRETDLA       180
     LFAKISKAAP MQGPEDVPLS LLVPAFVTSE LKTGFQIGFT IFIPFLIIDM VVASVLMSMG       240
     MMMVSPATVS LPFKLMLFVL VDGWQLLIGS LAQSFT                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page