(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLIQ

CP000124.FLIQ        Location/Qualifiers
FT   CDS             254466..254738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BURPS1710b_0244"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48012"
FT                   /db_xref="GOA:Q3JXP3"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP3"
FT                   /protein_id="ABA48012.1"
FT                   /translation="MTPENVMTLAHQAMYIGLLLAAPLLLVALAVGLVVSLFQAATQIN
FT                   EATLSFIPKLLAVAATMVIAGPWMLSTMIDYLRETLLRVATLGAG"
     MTPENVMTLA HQAMYIGLLL AAPLLLVALA VGLVVSLFQA ATQINEATLS FIPKLLAVAA        60
     TMVIAGPWML STMIDYLRET LLRVATLGAG                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page