(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLIS

CP000124.FLIS        Location/Qualifiers
FT   CDS             433248..433682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BURPS1710b_0419"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49678"
FT                   /db_xref="GOA:Q3JX70"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX70"
FT                   /protein_id="ABA49678.1"
FT                   /translation="MFTPGHAGASAYARVGVETGVMGASPHRLIAMLYQGARQAIAHAR
FT                   LHLQQGNVAARGEAIGKAIRIVESGLQQALNLEVGGDIASRLDSLYTYMCRRLLQANVD
FT                   ASEPMLIEVDGLLATLEDAWTGIAPEVARMNAQAVTEQAR"
     MFTPGHAGAS AYARVGVETG VMGASPHRLI AMLYQGARQA IAHARLHLQQ GNVAARGEAI        60
     GKAIRIVESG LQQALNLEVG GDIASRLDSL YTYMCRRLLQ ANVDASEPML IEVDGLLATL       120
     EDAWTGIAPE VARMNAQAVT EQAR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page